KEGG   Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1: SN31241_3550Help
Entry
SN31241_3550      CDS       T02779                                 

Definition
1,4-alpha-glucan branching enzyme GlgB
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
senn  Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:senn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SN31241_3550
Enzymes [BR:senn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SN31241_3550
Exosome [BR:senn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SN31241_3550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
368113..370158
Genome map
AA seq 681 aa AA seqDB search
MIEPKTGRKVGKLECLDARGFFCGVLPRRKNFFRYQLAVTWHGQQNLIDDPYRFGPLIQE
MDAWLLSEGTHLRPYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDGRRHPMR
LRKESGIWELFIPGAHNGQLYKFELLDANGNLRIKADPYAFEAQMRPETASMICGLPEKV
TPSEERQKANQFDAPISIYEVHLGSWRRHTDNNFWLSYRELADQLVPYAKWMGFTHLELL
PVNEHPFDGSWGYQPTGLYAPTRRFGTRDDFRYFINAAHAAGLNVILDWVPGHFPSDEFS
LAEFDGTHLYEHSDPREGYHQDWNTLIYNYGRREVSNYLVGNALYWMERFGIDALRVDAV
ASMIYRDYSRKEGEWIPNEFGGRENLEAIEFLRNTNRIIGEQVPGAVSMAEESTDFSGVT
RPPETGGLGFWYKWNLGWMHDTLDYMKLDPVYRQYHHDKLTFGMLYNHTENFVLPLSHDE
VVHGKKSILDRMPGDAWQKFANLRAYYGWMWAFPGKKLLFMGNEFAQGREWNHDASLDWH
LLEGGDNWHHGVQRLVRDLNHTYRHHKALHELDFDAYGFEWLVVDDNERSVLIFVRRDKA
GNEIIVASNFTPVPRHDYRFGINQPGRWREILNTDSMHYHGSNTGNGGVVHSDEIESHGR
QHSLSLTLPPLATIWLMREGE
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
gtgattgaacccaaaaccggacgtaaagtcggcaaactggaatgtctcgacgctcgcggt
tttttctgcggcgttttaccccgacgtaaaaatttctttcgctatcagctcgccgtgacc
tggcacggacagcagaacctcatcgacgatccttaccgttttggtccattaatacaggaa
atggatgcctggctattgtcggaaggcacccacctgcgtccttatgaaacgctgggcgcg
cacgccgatacgatggatggcgtcaccggcacccgtttctccgtttgggcgcctaatgct
cgtcgcgtttcggttgtcgggcaattcaactattgggatgggcgtcgccacccgatgcgt
ctgcgcaaagagagcggtatttgggagctgtttatccccggcgcgcataatggacaactg
tataaattcgagctgcttgatgcgaacggtaatctgcgcattaaagccgatccctatgct
tttgaggcgcagatgcgtccggaaacggcgtcgatgatttgcggactgccggagaaagtg
acgccaagcgaagaacgacaaaaagccaatcagtttgatgcgccgatctcgatttatgag
gtgcatttaggttcatggcgccgccatacggataacaatttctggctgagctatcgtgag
ctggcggatcagcttgtgccttacgccaaatggatgggctttacgcaccttgaactcttg
ccggtcaacgaacatccgtttgacggcagttggggctaccagccgaccggcctctacgcg
ccgacccgccgctttggtacgcgggacgacttccgctatttcatcaatgcggcccatgcg
gcgggccttaacgtcattctcgactgggtgccgggccatttcccgtccgatgaatttagc
ctcgcggagtttgacggcacccacctctatgagcacagcgacccgcgcgagggctatcac
caggactggaatacgctgatctacaactatggtcgtcgtgaagtcagtaattatctggtg
ggcaacgccctgtactggatggagcgttttgggattgatgcgctgcgtgtcgatgcggtg
gcctctatgatctaccgcgactacagccgcaaagagggcgagtggataccgaacgagttc
ggcggtcgtgaaaacctggaagccattgagtttctgcgtaataccaaccgcattattggc
gagcaggtgcccggcgcggtcagcatggcggaagagtcgacagacttctctggcgtgacg
cgtccaccggaaacgggtgggctggggttctggtacaagtggaatctgggctggatgcac
gacacgctggactacatgaagctggacccggtgtaccgccagtatcatcacgacaagctg
acctttggtatgttgtacaaccataccgaaaactttgttctgccgctgtcgcacgatgag
gtggttcacggcaagaaatccattctcgatcgtatgccgggcgatgcgtggcaaaaattc
gccaacctgcgcgcctattatggctggatgtgggccttccccggcaagaaactgctgttt
atggggaatgagtttgcccagggacgcgagtggaaccatgacgccagcctcgactggcac
ctgctggaggggggcgataactggcaccacggggttcagcgtctggtgcgcgatctcaac
cacacctatcgccaccataaagcgttgcatgagctggattttgatgcttacggctttgag
tggctggtggtcgatgacaatgaacgctcggtactgatttttgtacgccgtgataaagcc
ggtaacgagatcatcgtcgccagcaactttacgcccgtgcctcgccacgactaccgcttt
ggcatcaaccagccgggacgctggcgtgaaattctcaatactgattcgatgcattatcac
ggtagcaacaccggcaatggcggcgtggtgcacagcgatgagatcgaaagccatggccgt
cagcactctcttagcctgacgttaccgccgttggcgacgatctggctgatgcgggagggg
gaatga

DBGET integrated database retrieval system