KEGG   Staphylococcus epidermidis RP62A: SERP0813Help
Entry
SERP0813          CDS       T00229                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser00020  Citrate cycle (TCA cycle)
ser00640  Propanoate metabolism
ser00660  C5-Branched dibasic acid metabolism
ser01100  Metabolic pathways
ser01110  Biosynthesis of secondary metabolites
ser01120  Microbial metabolism in diverse environments
ser01130  Biosynthesis of antibiotics
ser01200  Carbon metabolism
Module
ser_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ser_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SERP0813 (sucC)
   00640 Propanoate metabolism
    SERP0813 (sucC)
   00660 C5-Branched dibasic acid metabolism
    SERP0813 (sucC)
Enzymes [BR:ser01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SERP0813 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Citrate_bind
Motif
Other DBs
NCBI-ProteinID: AAW54159
UniProt: Q5HPU5
Position
815834..817000
Genome map
AA seq 388 aa AA seqDB search
MNIHEYQGKEIFRSMGVAVPEGRVAFTAEEAVEKAKELNSDVYVVKAQIHAGGRGKAGGV
KIAKSLSEVETYANELLGKQLVTHQTGPEGKEVKRLYIEEGCDIQKEYYVGFVIDRATDK
VTLMASEEGGTEIEEVAAQTPEKIFKETIDPVVGLSPYQARRIAFNINIPKESVGKATKF
LLALYNVFIEKDCSIVEINPLVTTGDGQVLALDAKLNFDDNALFRHKDILELRDLEEEDP
KEIEASKYDLSYIALDGDIGCMVNGAGLAMATMDTINHFGGNPANFLDVGGGATKEKVTE
AFKIILGDDNVKGIFVNIFGGIMKCDVIAEGIVAAVKEVELTLPLVVRLEGTNVERGKAI
LNESGLAIEPAATMAEGAQKIVKLVKEA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccacgagtatcaagggaaagaaatatttcgttcaatgggcgttgcagttcca
gagggacgagtagcatttactgctgaagaagcagtggaaaaagcgaaagaattaaattca
gacgtatatgtggttaaagcgcaaattcacgctgggggtagaggtaaagcaggcggcgtg
aaaattgctaaatcattatctgaagtcgaaacgtacgcaaatgaactgctaggtaaacaa
ttggtcacacatcaaactgggccagagggcaaagaggtcaaacgtttatatatcgaagaa
ggatgcgatatccaaaaagaatattatgttggttttgttattgatcgtgctactgataaa
gtgactttgatggcatcagaagaaggtggaactgaaattgaagaggttgcagctcaaaca
cctgaaaagattttcaaagaaacaattgatccagtagtaggattatcaccttaccaagcg
cgacgtatcgcttttaatattaacattccaaaagaatcagttggaaaagcaactaaattt
ttattagcactatataatgtctttatcgaaaaagattgttctattgttgaaattaaccca
cttgttacaactggagacggtcaggtattggctttagatgctaaattaaactttgatgat
aatgcattatttagacataaagatattttagaattacgagatttagaagaagaagatcct
aaggaaatagaagcttctaaatatgatttatcatacatcgctttagatggagatattggt
tgtatggttaatggcgcaggtttagccatggcaactatggatacaattaatcattttggt
ggaaatccagccaacttcttagatgtaggtggcggtgctacaaaagaaaaggtaactgaa
gcatttaaaattattttaggtgatgacaatgttaaaggtatctttgtaaatatttttggt
ggaattatgaaatgtgatgttattgccgaaggtattgtagcagcggttaaagaagttgaa
ctaacattaccattagttgttcgtttagaaggaactaatgtcgaacgtggtaaagcaata
ttaaacgaatcaggtttagctattgagccagcagcaactatggctgaaggtgctcaaaaa
attgtgaaacttgttaaagaagcataa

DBGET integrated database retrieval system