KEGG   Salmonella enterica subsp. arizonae: SARI_02553Help
Entry
SARI_02553        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SARI_02553
Enzymes [BR:ses01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SARI_02553
Exosome [BR:ses04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SARI_02553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2475263..2476237
Genome map
AA seq 324 aa AA seqDB search
MTDLIHRPRRLRKSAALRAMFEETTLSLNDLVLPIFVEEELDDYKAIDAMPGVMRIPEKQ
LAREIERIANAGIRSVMTFGISHHTDDTGSDAWKEDGLVARMSRICKQTVPEMIVMSDTC
FCEYTSHGHCGVLCEHGVDNDATLANLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALD
AAGFTDTAIMSYSTKFASSFYGPFREAAGTALKGDRKTYQMNPMNRREAIRESLLDEAQG
ADCLMVKPAGAYLDVLREIRERTELPLGAYQVSGEYAMIKFAAMAGAIDEEKVVLESLGS
IKRAGADLIFSYFALDLAEKNILR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacagaccttatccatcgccctcgccgcctgcgcaaatccgctgcgttgcgcgccatg
tttgaagagacaacactcagcctgaatgacctggtgttgccgatctttgttgaagaagaa
ctcgacgattacaaagctattgatgccatgcccggcgtgatgcgcatcccggaaaagcag
ctagcgcgagagattgagcgtatcgctaatgctggtattcgttccgttatgaccttcggc
atttctcaccatactgatgacaccggcagcgatgcctggaaagaagacggtctggtggca
agaatgtcccgcatctgtaagcaaaccgtaccggaaatgatagtcatgtccgatacctgc
ttctgcgaatacacctcgcacggacactgtggcgtgttgtgcgaacacggtgtggataac
gatgcgacactggctaacctcggcaagcaggccgttgtcgcggcggcggcgggggccgat
tttattgcgccctctgcggcaatggatggacaagtccaggccatccgccaggcgctggac
gccgccggttttaccgacacggcaataatgtcctactcaaccaagttcgcctcttctttc
tacggtcccttccgtgaagcagcaggtaccgcgttaaaaggcgatcgcaaaacgtatcaa
atgaacccgatgaaccgccgtgaagcgattcgcgaatccctgctcgacgaagcccagggc
gcggattgcttaatggtgaaaccggccggcgcatatctggacgtgctgcgtgaaatccgc
gagcgcacagagttgccgcttggcgcttaccaggtgagcggcgaatatgccatgattaaa
tttgctgctatggctggcgccattgatgaagaaaaagtcgtgctggaaagtctgggctcg
attaaacgcgctggcgccgatttgatcttcagttacttcgcgctggatctggcggagaaa
aacattctgcgttaa

DBGET integrated database retrieval system