KEGG   Streptococcus equi subsp. equi 4047: SEQ_1436Help
Entry
SEQ_1436          CDS       T00877                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:seu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1437446..1438948)
Genome map
AA seq 500 aa AA seqDB search
MTKRASGILMHISSLPGRFGIGSFGKEAFEFVDFLKETKQTYWQILPLTTTSFGDSPYQS
FSAIAGNTHFIDLELLAKDGYLQEADYAAVDFGSNPESVDYAQVFQARRPLLEKAVQAFV
STEEGLRQLAEFEATASWLNDFAEFMAIKEHFDHKALQEWDDRAIVKREEAALLHYRKLL
AKGITYHKVCQYFFYQQWLALKTYANQNGITIIGDMPIYVSADSVEVWTMPELFKVDADK
KPIYIAGVPADGFSEDGQLWGNPIYNWESHEQTGFAWWIHRIKESFKLYDKLRIDHFKGF
SDFWEIPGGDVTAKNGHWESAPGIALFKAVREALGELPIIAENLGYIDEKAEQLLASTGF
PGMKILEFGLFDVTSQSFDLPHNYDHNCIVYTGTHDNEVVNGWYEHLSAEQVEFVNHYIH
KAAAESITKAMLRTIFATVCDTAILCMQDLLDKSADSRMNMPNTVGGNWQWRMLEDDIKA
EHKAYLIHLTELYGRANNHH
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgactaaacgtgcaagtggtattctgatgcatatcagctcgcttccgggacgcttcggt
attgggagctttggtaaagaggcctttgaatttgttgactttttaaaggaaaccaagcag
acctattggcagattttgcccttaacaacaactagctttggagattctccttatcaatct
ttttcagctattgcaggaaatacgcattttattgaccttgaattgctggcaaaggacggt
tatttgcaggaagctgattatgctgctgttgattttggctcaaatccggagtctgttgat
tacgctcaagtctttcaagccagacgccctttattagaaaaagcagttcaggcttttgtc
tcaactgaggaaggcttaagacagctcgccgaatttgaagcaactgcgagctggctaaat
gattttgctgaatttatggctattaaagagcattttgatcacaaggccctccaggaatgg
gacgatagagcaattgttaagcgtgaagaggctgccttgcttcattaccgcaagctgttg
gccaaaggcatcacctatcataaggtctgccaatatttcttttatcagcagtggctagcg
ctgaagacctatgctaatcaaaatggcattactatcattggtgatatgccaatctacgtg
tctgctgatagcgttgaggtttggacgatgccagagctctttaaggtggatgcagataaa
aagccgatttacattgcaggtgtacctgctgatggctttagtgaggacgggcagctttgg
ggcaatcctatttacaactgggagagccatgagcaaacaggctttgcttggtggatccat
cggatcaaagagagcttcaagctgtacgataagcttagaattgaccatttcaagggcttc
tcagatttttgggaaattcctggtggtgatgtgactgctaaaaatggtcattgggagtca
gctcctggtattgctctatttaaagctgttcgagaggccttgggtgagctgccaattatc
gcagaaaaccttggctacattgatgaaaaggctgagcagctgctggcatctactggcttt
ccgggcatgaagattttagagtttggtttgtttgatgtgacaagtcaaagctttgatttg
ccgcataactatgatcacaattgcattgtctacactggtacgcatgacaatgaggtggtg
aatggctggtatgagcacttgagcgcagagcaggttgagtttgttaatcattatatccat
aaggcagctgctgaaagcatcaccaaggccatgctaagaacaatctttgcgactgtgtgt
gatactgctatcctgtgtatgcaggatttgctggataagtcagctgatagccgaatgaat
atgccaaacactgtcggtggcaactggcagtggcgcatgcttgaggacgatattaaagca
gagcacaaggcctatttaatccatttgactgagctatacggtcgagccaataatcatcac
tag

DBGET integrated database retrieval system