KEGG   Streptococcus equi subsp. equi 4047: SEQ_1682Help
Entry
SEQ_1682          CDS       T00877                                 

Definition
glycosyl hydrolase family 2 protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SEQ_1682
  Lipid metabolism
   00600 Sphingolipid metabolism
    SEQ_1682
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SEQ_1682
Enzymes [BR:seu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SEQ_1682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1688272..1691715)
Genome map
AA seq 1147 aa AA seqDB search
MSVETITGSTDQSHGDIYQLHWIDKVGRCHAFSKGWRFLMADLQLAQEPFFDDSDWQQIA
LPHDFSINQPYTVNGEAQSAYKLGGVGWYRKYFALDPKLADHKVYVTFDGAYMETQVYLN
GHLIGEHVNGYQAFSYDLSAFVIPGQENLLAVRVEHLVPSSRWYSGSGLYREAFLTVLPK
VHLDKDRLRLSLSQAALEADSQALEIELGLSQQVPLSGYQLSLSLFEQLADIQQRQTVYE
SKPVALDLLEESGRLVMTIPLRHIKLWSPAQPQLYQLDMLLYHKGAVLDRLTLETGFRQL
HFDAECGFFLNGKAFKLQGVCLHHDQGSLGACAYEEAIARQLVLLKEMGANTVRVTHNPS
ARRLKDLANRLGLFLIEEAFDTWTYAKNGNSHDFSSHFHKTVGHQNAARLKGVTTAETTW
AQYSIQAMVLSGLHDPSVLMWSIGNELLEGFSADVSHYPYVAKELCQWITELDQSRPITL
GDNKLKDKHFHWAQETKALAEQVNQLQSVQGVIGLNYAKARDYDRLHRDNPTWLLYGSET
ASAINSRGVYHLKGGASQDHELTSYDQSTVDWGSLASEAWYDTITRDFVAGECVWTGFDY
LGEPTPWNKIDSGAADQWPSPKQSYFGILDTAGFAKDSYYFYQSQWSKDKTTLHILPSWQ
EKDLQLDDQGMVEVVVYSNAASVRILFDDGHGGQIDYGIKTLTRHETPAGHCYQLYEGDD
AAELPHQNLYLTWKLPYRSGSLRAIAYDDKGQVLTQTSGRSCVSSYQQPAQLSWSCFEPP
KLLAEPALLYLELSLLDANETLVLSANPVIKLEVEGPGACLALDNGDPRDHRPYTALSRR
AYGGKLLAIIALDGRAGQLRITARAAGFVEASYQLTVSEAAVNEKLLAYQLDKYSFITNE
TNKPSKPYARSRGSAVDSLMPNPDSCLKRQGHYLPDNSVMVFSYTTALSRPLTFQPLIKR
LLKGNDIILPDWLQPRAAAGQLFTKAFPIDWQLTEAVFSEESRVSGQTLCFGEALELEAI
LKSDTKGLRINQELSLVAKKKRLFQSDTQLSYRYQYDTIQAIGAISLTGLKKPLSSLRLV
LDYRSSTNAPSKQLILSLDQIEQPCHYIMLEEVVDVLSLDLTLEQPIRQAFDLARLQLGL
WSMVEEA
NT seq 3444 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtagagacaatcactggttcaacggatcaatctcatggggatatctatcagctt
cactggattgataaagtagggcgctgccatgccttttcaaaggggtggcgctttctgatg
gctgatttgcagctcgctcaggagccattttttgatgattcggactggcagcagatagct
ttaccacatgattttagcattaatcagccctatacggttaatggcgaagctcaaagtgcc
tataagctaggtggtgtaggctggtaccggaagtattttgcccttgatccaaagctggct
gaccataaggtctatgtgacctttgatggggcttatatggaaacgcaggtataccttaat
gggcatttgataggagagcatgtcaatggctatcaggcctttagctatgatctctcagcc
tttgtaatccctgggcaagagaatctattagcggttcgggttgaacatctggtgcctagc
tcgcgttggtattctggaagtgggctttatcgggaggcttttttgaccgttcttccgaag
gttcatcttgataaggatcggcttcgtttatccttatcccaggcagcgcttgaggctgat
agccaagcgcttgagatagagcttggactcagccaacaggtccccttgagtggctatcag
cttagccttagtctgtttgagcagctggcagatatccagcagagacagacagtatatgag
agtaaaccggtagccttggacctcttggaggagtcaggtaggctggtgatgaccattcct
cttaggcatatcaaactgtggtcgccagctcagccccagctctatcagcttgatatgctt
ctttaccataagggagcagtgcttgatcggctgacacttgaaacaggctttcgacagctg
cattttgatgctgagtgtggtttctttttgaatggcaaagcctttaagctgcaaggggtc
tgtcttcatcatgatcagggtagcctgggggcatgtgcttatgaggaagctatagctagg
cagcttgttttgctaaaggaaatgggagcaaatacggttcgtgtcacgcacaaccctagt
gccagaaggcttaaggatctggctaacaggcttgggttatttctcattgaggaagccttt
gatacctggacttatgctaaaaacggtaatagccatgatttttcaagccattttcacaag
acagtgggacaccaaaatgcagccaggctaaagggagtcactacagcagaaaccacctgg
gcgcaatatagcatacaggccatggttctctcaggtcttcatgatccatctgtcttgatg
tggtcaatcggcaatgaattgttagaaggcttctcagctgatgtgagccactacccttat
gttgctaaggagctatgccagtggatcactgagctggatcagtcaagacctattaccctt
ggggataataagctcaaggacaagcattttcattgggcgcaggaaacaaaagcgttggca
gagcaggtcaatcagctccagtccgtgcaaggagtgattggacttaactatgctaaggcc
agagattatgatcgattgcatagggacaacccgacttggctgctttatggctcagagaca
gcctctgctattaatagtagaggggtctatcatctcaagggaggagctagtcaggatcat
gagctaacctcctatgaccagtcaacggttgactggggatccttagctagtgaggcttgg
tatgatacaatcacaagggattttgttgcaggtgagtgtgtttggacgggctttgattat
ctaggggagcctactccttggaacaagattgactcaggcgcagctgatcagtggccgtcg
cccaagcaatcctactttggtattttagatactgctggatttgctaaggatagctattat
ttctaccaaagccaatggtcaaaagacaaaacgacacttcatatcctgcccagctggcag
gaaaaagaccttcagctagatgatcagggcatggtggaggttgtggtttatagtaatgct
gctagtgtgagaatactttttgatgatggtcatgggggccagattgattatggcatcaag
accctgacaaggcatgaaacaccagcaggccattgctaccagctatatgagggtgacgat
gcagcagaattacctcatcaaaacctttacctgacatggaagcttccttatcgctcaggc
agcttgagagctattgcttatgacgacaagggacaggtgctcacacagaccagcggtcgt
tcctgtgtgagcagctaccagcagcctgctcagctttcctggtcctgctttgagcctcct
aaactgcttgcagagcctgcgctactttatcttgaattgtctttgttagatgctaatgag
accttggtgctcagtgctaatcctgtgattaagcttgaggttgagggtcctggagcctgc
cttgctctggataatggcgatcctcgtgaccataggccctatactgccttgtcacgccga
gcatatggtggcaagctattagccattattgctcttgatggtcgtgcgggtcagcttaga
ataacagctagagccgcaggattcgtggaagccagctatcagttgacggtttctgaagca
gccgttaatgagaagcttttagcctatcagcttgataaatacagctttatcactaatgag
acaaataagcctagcaagccctatgcaaggtcaagaggatcagctgttgatagcttaatg
cctaatcctgatagctgcttaaagcggcaaggccattatctgcctgataattctgtaatg
gtttttagctatacaacagcattatcaaggccactgacctttcagccactgatcaaaagg
ctgctaaagggcaatgatatcattctaccagactggctgcagcctagggcagctgctggc
cagttatttaccaaggcttttcctattgattggcagctaacagaggcagttttttctgag
gagtcaagggttagtgggcagaccctttgttttggagaggctttggagcttgaagctatc
cttaagtcagatacaaaaggattaaggatcaatcaagagcttagcttagttgctaaaaag
aagcggctgtttcagagtgatacccagcttagctaccgctatcaatacgataccatacag
gccattggtgccattagcctgacaggactaaagaagcccttaagctcgcttaggcttgtt
ttggactatcgcagcagcaccaatgcgccatcaaaacagctgatcctatcgcttgatcag
atagaacagccctgtcactacatcatgctggaagaagtagttgatgtgctaagcctggac
ctaacattagagcagccgatcagacaggcttttgacttagctaggcttcagctaggcctt
tggagcatggttgaggaggcttag

DBGET integrated database retrieval system