KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A3134Help
Entry
SeSA_A3134        CDS       T00743                                 

Gene name
fucA
Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sew00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3029945..3030592)
Genome map
AA seq 215 aa AA seqDB search
MERNRLARQIIDTCLEMTRLGLNQGTAGNVSVRYQGGMLITPTGIPYEKLTESHIVFIDA
DGQHEQGKLPSSEWRFHMAAYQTRPDANAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGG
NSIPCAPYATFGTRELSDYVAVALKNRKATLLQHHGLIACEENLDKALWLAHEVEVLAQL
YLSTLAIVDPVPVLDDGAIAIVLEKFKTYGLRIEE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaacgaaatagactggcgcggcagattattgatacctgtctggaaatgacgcggtta
gggttaaatcaggggacggcaggtaacgtgagcgtacgttatcagggcggaatgctgatt
acgccgacggggatcccctacgagaagctgacagagtcgcacattgtttttattgatgct
gacggtcagcatgagcagggcaagctgccttccagcgagtggcgttttcatatggcggca
taccagacgcgccctgacgccaatgctgtggtacataaccacgctgtccattgtacggca
gtctcgatcctgaatcgcccgattccggcaattcactacatgattgccgccgcaggggga
aactctattccctgcgcgccctacgccacttttggcacccgcgaactttctgactatgtt
gccgtggcgcttaaaaatcgtaaagcgacactgttacagcatcacgggcttatcgcttgt
gaagaaaatttagacaaagcgttgtggctggcgcatgaagtggaagtgctggcgcagctc
tatttaagtacgctggccattgtcgatccggtaccggtactggatgacggggcgatcgct
atcgtactggagaaatttaaaacttacggattacgtattgaagagtga

DBGET integrated database retrieval system