KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_0787Help
Entry
Sez_0787          CDS       T00746                                 

Gene name
glgB
Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sez00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sez_0787 (glgB)
Enzymes [BR:sez01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Sez_0787 (glgB)
Exosome [BR:sez04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sez_0787 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
818471..820351
Genome map
AA seq 626 aa AA seqDB search
MDNDLALYTFGTGENFHVQDYLGVHRINNDTGTSYVFRVWAPNAEAVSLIGDFTDWQSNP
LEMSRNEAGVWELVTSLPHEGDIYKYWVRRQGGQLVEKIDPVAFLFEARPGTGAIVKTLP
VKKWRDSLWLGRRKRFGFRQRPVNIYEVHAHSWKKDENARPYDFSKLKEELIPYLKSMHY
THVEFMPVMAHPLDMSWGYQLMGYFAFESTFGSPEAFQDFVEACHLNNIGVLIDWVPGHF
TQNDDALAYFDGTATYEYQDHHRAHNYGWGALNFDLGKTQVQSFLISSALFWLEAYHVDG
IRVDAVSNMLYLDYDQGPWTPNQYGGNQNLEGIAFLQKLTTVIKEKHPDVMMIAEEATSA
TPITSPVAEGGLGFDYKWNMGWMNDILRFYEEDPYYRKYDFNLLTFSFMYCFKEHYILPF
SHDEVVHGKKSLMHKMWGDRYNQFAGLRNLYTYQICHPGKKLLFMGSEFGQFLEWKYDHQ
LEWQNLEDELNAKMQHFTASLNQLYKDHSMLWQNDETYDGIDIIDADNKDESVLSFCRKN
NKGELLLCVFNMTPVERPGFTIGVPIAGLYEEIFNTELEAFGGVWKEHNPLTNTVAKKWK
TYPQTLSFTLPALGASIWKIKRRQKQ
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggataatgacttagcgctttatacctttggcacaggtgagaatttccatgtacaggat
tatctaggtgttcatcgtattaacaatgacacaggcaccagctatgtctttagggtatgg
gcgcccaatgcagaggctgtcagcttgattggagattttactgattggcagtccaatcca
cttgagatgagccgaaatgaggctggtgtgtgggagcttgtcactagtctgcctcatgaa
ggagatatttataagtactgggttaggcgccaaggtggtcagcttgttgaaaaaattgat
ccagtggcctttctatttgaagctagaccaggaacgggtgctattgtcaaaacccttccg
gttaaaaaatggcgtgatagcttatggctgggacggcgaaagcgttttggctttaggcag
cgtccagttaatatctatgaggttcatgcccattcatggaaaaaagacgaaaacgcaagg
ccttatgactttagcaagctgaaagaagagctcattccctatctcaagagcatgcactac
actcatgttgaatttatgccggtcatggctcaccccttagacatgagctggggttatcag
ctgatgggttactttgcctttgagtcaacctttggaagcccagaagcctttcaggatttt
gttgaggcttgtcatcttaataatattggtgtcttgatcgactgggtaccagggcatttt
acacaaaatgatgacgccttagcttattttgacggtacagctacctatgaatatcaggat
caccatcgtgctcataattatggctggggggccctaaattttgatttgggtaaaactcag
gtacagtcctttttgatttcaagtgcccttttttggctggaggcttatcatgttgatggt
attcgagtagatgctgttagcaatatgctttacttggattatgatcagggtccttggact
cccaatcaatacggaggcaatcaaaaccttgaggggatagcctttcttcaaaaattaacc
acagttatcaaggaaaaacaccctgatgtgatgatgattgcggaggaggcgacctcagct
accccaataacaagccctgttgcagaaggtggactaggctttgattataagtggaatatg
ggctggatgaatgatattcttaggttttacgaagaggacccttattatcgaaaatacgat
ttcaatctcttaacctttagttttatgtattgctttaaggagcattacattttacccttt
tctcacgatgaggttgttcatggcaaaaaaagcctcatgcataaaatgtggggggaccgc
tacaatcaatttgcaggcctaagaaatctttacacctatcaaatctgccacccaggcaag
aagctgctttttatgggatctgagtttggacagtttttggaatggaaatacgatcatcaa
ttagagtggcaaaatttagaggacgagctcaatgctaaaatgcagcatttcacagccagc
ctaaatcagctatataaggaccatagcatgctgtggcaaaatgatgaaacctatgacggc
attgatattattgatgcagacaataaggacgaatcagtcttgtcgttttgtcgtaaaaac
aataaaggagagctcttgctttgtgtctttaatatgacacctgttgaaagaccaggcttt
accataggtgtgccgatagcaggtctttacgaagaaattttcaatacagagcttgaggcc
tttggaggtgtctggaaggagcacaatcccttaaccaacacagtagccaagaaatggaag
acttatccgcagaccctgagctttaccctgcctgccttaggagcaagcatctggaaaatc
aagcgtcgtcagaagcaataa

DBGET integrated database retrieval system