KEGG   Spirochaeta africana: Spiaf_0101Help
Entry
Spiaf_0101        CDS       T01811                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sfc  Spirochaeta africana
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Spiaf_0101
Enzymes [BR:sfc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Spiaf_0101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(122949..124931)
Genome map
AA seq 660 aa AA seqDB search
MKFPGFTHNLTGVAVPVSALRSPESLGCGEFADLLPLAEWCKQTGLEVIQLLPINDTGSQ
SSPYFALTAFALHPMYLRVQDLPELGDLPDLAKKVKSKITRAKKTLNAHERMDYQGTLTT
KMELVNTIFAEHADAILSSKPLADWIAANHWVKEYAVFKVLKAENQERSWVEWDSFQEPA
PGDIEKRWSEKKLQREHMFHAWLQWRLENQLREVVGRLDEMDVFLKGDLPILMNEDSADV
WAHRDIFITRLRAGAPPDMFSADGQNWGFPIYDWDTLAEQDYGWWKDRLRQSDKFYHAYR
IDHVLGFFRIWSIPEANTLGTLGYFFPSAFIAQEELRRHGLDDARIRWLAEPHIQGEQIR
DTLGEYHEAIVSRVFSQIFDQDLYTFSRKVHGEKFFDQLDIPDNIRGVLRAWYKDRALIE
VEDGIYAPSWTFRECSRYHALSDHEKGAFEHLVATHANRSEAMWAENGRRLLSFMSQTVP
MLTCAEDLGVIPDCVPQVLGELGILSLRIPRWSRDWNAPGQPYVSLQDYPALSVCTPSVH
DTSTMREWWEREGEQEGFWHSLGFQEPCPGEFTADTAMRVYQRLLECNSQICMFQIQDLF
VLDPELRVEDPGLERINVPGTLNDFNWTYRIPMDVQELKKYTTLNTRVAELTGPRAERTV
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcccaggttttacccacaacttaaccggcgttgcggtgccggtttccgcgctg
cgcagccccgaaagccttggctgtggagaattcgccgatctgctgccgctggcagaatgg
tgcaaacagacaggccttgaggttatccagctgttgccgataaacgataccggctcgcag
agttcgccctattttgcgcttaccgcctttgcgctgcatccgatgtacctgagggtacag
gatctgccagagcttggcgatctgccggatctcgctaaaaaggtcaaatcaaagattacc
agagcaaagaaaaccctgaatgcccatgagcgcatggactatcaggggacgctcaccacc
aagatggagctggttaacaccattttcgccgagcatgccgacgcaatcctgtcctctaaa
ccactggctgactggattgccgccaaccactgggtaaaggaatacgcggtattcaaggtg
ctcaaggcagaaaaccaggagcgcagctgggtagagtgggactctttccaggagccggca
cccggggatatcgagaagcgctggagcgagaaaaaactgcagcgcgagcacatgtttcac
gcatggctgcagtggcgcctggagaaccagctgcgcgaggttgttggtcgtctggacgag
atggatgtgtttctgaagggcgacctgcccatcctgatgaacgaggacagcgctgacgtg
tgggctcaccgtgacatctttataacccgcctgcgtgccggggcaccgccggatatgttc
tcggcagatgggcagaactggggattccccatctatgactgggacaccctggcagaacag
gattatggctggtggaaggatcgcctgcggcagtcagacaagttctatcatgcttaccgg
atcgaccacgtgctgggatttttccgcatctggagcatccccgaggcaaataccctcggc
accctgggatacttcttcccttcggcctttattgcccaggaggaattgcgccgacacggg
ctggatgatgcacgaatccgctggctggccgagccgcacatccagggggaacagattcgt
gacaccctgggggaataccatgaggcgatcgtatcccgggtattctcacagatcttcgac
caggatctgtataccttcagtcgcaaggtgcacggggaaaagttctttgatcagctggat
attccggataatattcgcggcgtcctgcgtgcctggtacaaggatcgagccctgatcgag
gtagaagatggcatctatgccccgtcatggaccttccgggaatgctcccgctaccacgcc
ctgtctgatcacgagaagggtgcttttgagcacctggtagcgacccatgccaatcgatcc
gaagcaatgtgggccgaaaacggccgacgactgctgtcattcatgagtcaaaccgtgccg
atgctgacctgtgccgaggatctgggggttattccggactgcgtgccccaggttctgggc
gagctgggcatcctgagcctgcgcatcccccgctggagcagggactggaatgcgccggga
cagccgtatgtatcgctgcaggactacccggccctgagcgtctgtacaccctcggtacat
gataccagcactatgcgtgaatggtgggaacgtgaaggggaacaggaaggattctggcac
agtctcggattccaggaaccctgcccgggtgaattcactgccgataccgccatgcgggta
taccagcgactgcttgagtgcaattcccagatctgtatgttccagatccaggatctgttc
gtcctggatccggaactgcgggtagaggatccgggtctggaacgaatcaacgtgcccgga
accctgaatgatttcaactggacctatcgcatcccgatggatgtacaggaactgaagaaa
tacacaaccctgaatacacgggttgccgaactgaccggcccacgagccgaaaggacagtc
tga

DBGET integrated database retrieval system