KEGG   Spirochaeta africana: Spiaf_0260Help
Entry
Spiaf_0260        CDS       T01811                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sfc  Spirochaeta africana
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sfc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Spiaf_0260
   00052 Galactose metabolism
    Spiaf_0260
   00500 Starch and sucrose metabolism
    Spiaf_0260
   00520 Amino sugar and nucleotide sugar metabolism
    Spiaf_0260
Enzymes [BR:sfc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Spiaf_0260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(320126..320971)
Genome map
AA seq 281 aa AA seqDB search
MKGVILAGGYGTRFLPVTKTIPKEMLPLVNKPAIAFIMEEFAAAGINEVLIISSRRKRSL
EDYFDREVELEGVFSQEQKHDYLAQIAPERMQVYFTRQQKMMGTGHALMQAEAFVGSDPF
VVAYPDDLHFGATPLAAQLVETFHITGKTVMAGLDNPPNLERYGVLSLADDNLHVTDIVE
KPAPGTAPSRLASIGRYLYTPEIFGFLQEGWAKHLAESPESEYYHVYALKQLMSRGRVVQ
HTIEGERLDTGAPTGFLQAFLHVAAQDPELATVIREFAAGM
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcgtaattctggcgggtggatacggcacccgctttctcccggtcaccaaaaca
atacccaaagagatgctgccgctggtgaacaaaccggcaatagcattcatcatggaggag
ttcgcagccgctggcatcaacgaggtactgataatctcatcccgacgcaaacgcagcctg
gaggattacttcgatcgcgaggtggaactggaaggggtgttctcgcaagaacagaaacac
gattaccttgctcagatagcaccggagcgtatgcaggtctactttacccgacagcagaaa
atgatggggactggtcatgccttgatgcaggcagaggcttttgtcggtagcgaccccttt
gtggtggcctacccagacgatctgcatttcggcgccacaccgctggcggcccagctggtg
gaaacttttcatattaccggcaaaaccgttatggccggattggataaccccccgaacctc
gaacgctacggggttctctccctggcagacgacaatctgcacgtaaccgatattgtggaa
aaaccggctcccggaaccgctcccagcaggcttgccagtattggccggtatctgtatacc
cccgagatattcgggtttttgcaggaggggtgggccaaacacctggctgaatcacccgaa
tccgaatactaccacgtgtatgctctgaagcagcttatgagccgcggccgggtggtgcag
cacaccatcgagggagaacggttggacaccggcgcgccaaccggttttttacaggctttc
ctgcatgtcgctgcacaggatcctgaactggcgacggttatccgggagtttgcagccggg
atgtaa

DBGET integrated database retrieval system