KEGG   Sinorhizobium fredii USDA 257: USDA257_c36760Help
Entry
USDA257_c36760    CDS       T02188                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase TrpC
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sfd01100  Metabolic pathways
sfd01110  Biosynthesis of secondary metabolites
sfd01130  Biosynthesis of antibiotics
sfd01230  Biosynthesis of amino acids
Module
sfd_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    USDA257_c36760 (trpC)
Enzymes [BR:sfd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     USDA257_c36760 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AFL52226
UniProt: I3X8M0
Position
complement(3833597..3834412)
Genome map
AA seq 271 aa AA seqDB search
MTDILRKIEAYKREEIAAAKSRVPLDALRARIADQSSPRGFHAALAARRQKGEFGLIAEI
KKASPSKGLIRPDFDPPGLAKAYAAGGAASLSVLTDTPSFQGAPEFLTAARAACSLPALR
KDFMFDTYQVFEARAWGADCILLIMASLTDDDAHRLEDAAFALGMDVLVEVHDAEEMERA
LRLSSPLIGINNRNLRTFAVDLAVSEQLAPMVPADRLLVGESGIFTHEDCKRLEKSGITT
FLVGESLMRKDDVGAATRALLTGSGSALAAE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgacggacattctgcgcaagatcgaggcttacaagcgcgaggagatcgctgccgcgaaa
tcgcgcgttccactcgacgcgctgagggcgcggatcgccgatcagtcgtcgccgcgcggc
tttcacgccgcgcttgcggcgcgtcgccagaaaggcgaattcggtctgatcgccgaaatc
aagaaggccagtccatcgaaaggattgattcgcccggatttcgatccgcctgggctggcg
aaagcctatgcggcgggcggggctgccagcctttcggtcctgacggatacgcctagtttt
cagggcgcccccgaatttctgacggcggcgcgggccgcctgttcgctgccggcgctgcgc
aaggacttcatgttcgatacctaccaggtcttcgaagcccgcgcctggggcgcagactgc
attctgctgatcatggcatcgctcaccgacgacgatgcacaccgtctcgaagacgcggcg
tttgcgctcggcatggatgtgctcgtcgaggtgcatgacgcggaggaaatggagcgagcg
ctgcggctgtcgtctcccctcatcggcatcaacaaccgcaacttgaggacgttcgcggtc
gatcttgccgtttcggaacagctcgcgccgatggtcccggccgatcgcctgctggtcggc
gaaagcggcatcttcacgcatgaggactgcaagcgcctcgaaaagagcggcatcacgaca
tttctcgtcggcgaaagcctgatgagaaaagacgacgtgggggcggcaacgcgcgcgctg
ttgaccggctccggaagcgctctggcagccgagtga

DBGET integrated database retrieval system