KEGG   Sinorhizobium fredii USDA 257: USDA257_c36760Help
Entry
USDA257_c36760    CDS       T02188                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase TrpC (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sfd01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:sfd00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3833597..3834412)
Genome map
AA seq 271 aa AA seqDB search
MTDILRKIEAYKREEIAAAKSRVPLDALRARIADQSSPRGFHAALAARRQKGEFGLIAEI
KKASPSKGLIRPDFDPPGLAKAYAAGGAASLSVLTDTPSFQGAPEFLTAARAACSLPALR
KDFMFDTYQVFEARAWGADCILLIMASLTDDDAHRLEDAAFALGMDVLVEVHDAEEMERA
LRLSSPLIGINNRNLRTFAVDLAVSEQLAPMVPADRLLVGESGIFTHEDCKRLEKSGITT
FLVGESLMRKDDVGAATRALLTGSGSALAAE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgacggacattctgcgcaagatcgaggcttacaagcgcgaggagatcgctgccgcgaaa
tcgcgcgttccactcgacgcgctgagggcgcggatcgccgatcagtcgtcgccgcgcggc
tttcacgccgcgcttgcggcgcgtcgccagaaaggcgaattcggtctgatcgccgaaatc
aagaaggccagtccatcgaaaggattgattcgcccggatttcgatccgcctgggctggcg
aaagcctatgcggcgggcggggctgccagcctttcggtcctgacggatacgcctagtttt
cagggcgcccccgaatttctgacggcggcgcgggccgcctgttcgctgccggcgctgcgc
aaggacttcatgttcgatacctaccaggtcttcgaagcccgcgcctggggcgcagactgc
attctgctgatcatggcatcgctcaccgacgacgatgcacaccgtctcgaagacgcggcg
tttgcgctcggcatggatgtgctcgtcgaggtgcatgacgcggaggaaatggagcgagcg
ctgcggctgtcgtctcccctcatcggcatcaacaaccgcaacttgaggacgttcgcggtc
gatcttgccgtttcggaacagctcgcgccgatggtcccggccgatcgcctgctggtcggc
gaaagcggcatcttcacgcatgaggactgcaagcgcctcgaaaagagcggcatcacgaca
tttctcgtcggcgaaagcctgatgagaaaagacgacgtgggggcggcaacgcgcgcgctg
ttgaccggctccggaagcgctctggcagccgagtga

DBGET integrated database retrieval system