KEGG   Serratia fonticola GS2: AV650_12180Help
Entry
AV650_12180       CDS       T04716                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
sfg  Serratia fonticola GS2
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AV650_12180
   00500 Starch and sucrose metabolism
    AV650_12180
Enzymes [BR:sfg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     AV650_12180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2660257..2661690
Genome map
AA seq 477 aa AA seqDB search
MTYSISKAEQELQAKRETLNLRWYPRYHLAARAGWINDPNGLVWFDGWYHAFYQHHPYST
QWGPMHWGHARSKDLVHWEHLPVALAPEGPEDKDGCFSGSAVVDGDTLALIYTGHKFHGD
TSDEANLYQVQCLATSRDGVCFERQGIVVDTPPGLHHFRDPKVWREGDSWYMIVGARDGE
TGQVRLYRSEDLHQWHDAGVLDEAEKEMGYMWECPDFFTLGDKHILMFSPQGMAAEGFNN
RNLFQSGYLLGEWQPGQPFVRKSEFIELDHGHDFYAPQSFLTPDSRRIVIGWLDMWESPL
PEQQDGWAGMLSLPRELSLGADNRLQMRPAKEVEGLRGAWFPWPVSTLKNQQTTMVENCE
AMEVILNWDCANSSAEQYGISFGEGLRVYVDAQMQRLVLERRYPQYGLCGVRSVPLTAGA
SLKLRLFFDSSSVEVFANDGEACLSSRIYPDAARRELMLFAWSGSASLSEAGAWQLE
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacgtattcaatatccaaggctgaacaggaactgcaggctaaacgtgaaacgctgaac
ttgcgttggtatccgcgctatcaccttgccgcgcgcgcaggctggattaacgatcctaac
ggtctggtctggtttgacggctggtatcacgctttttaccagcatcatccgtattccacg
cagtgggggccgatgcactggggccatgcgcgcagtaaagatctggttcattgggagcac
ctgccggtcgcgttggctccggaaggcccggaagataaagacggctgcttctctggctcg
gcggttgttgatggcgatactctggcgttgatttataccgggcataaattccatggcgac
accagcgatgaggctaacctttatcaggtgcagtgtcttgcgactagccgcgacggggtc
tgctttgagcgtcaggggatcgtggtagatactccgccgggtctgcaccatttccgcgat
cctaaggtgtggcgtgaaggggatagctggtacatgatagttggcgctcgcgatggcgag
accggccaggtgcgcctgtaccgttcggaggacctgcatcagtggcacgatgcaggtgtc
cttgatgaggcggaaaaagagatgggctatatgtgggagtgcccagatttcttcaccctc
ggggataaacacatcctgatgttttctcctcaggggatggcggccgaaggtttcaacaac
cgtaatctgttccagagcggctatctgctcggtgaatggcagccggggcagccgtttgtt
cgcaaaagcgagtttattgaactcgaccacggccacgatttttatgcaccgcaaagcttc
ctgactcccgatagccgccgcatcgttatcggctggctggatatgtgggaatcgccgttg
cccgaacagcaagatggctgggcgggaatgctctctcttccgcgagaactgagcctcggc
gcagataaccgtctgcaaatgcgtccggccaaagaggtagaaggtctgcgcggcgcatgg
ttcccatggccagtgagtacgttgaaaaatcagcagaccacgatggtagaaaactgcgaa
gcgatggaggtgatcctaaactgggattgtgctaacagcagcgcagaacagtatggcatc
agcttcggcgaggggctgcgcgtttatgttgatgcgcagatgcagcgtctggttctggag
cgccgttatccgcagtatggcctttgcggggtacgtagcgtaccgttgacagccggagca
tcgctgaaactgcggttgttctttgatagctcctccgtggaagtttttgctaatgatggc
gaagcgtgcctcagcagccgtatttacccggacgctgcgcgccgtgagctaatgctattt
gcctggagcggttcggcctccctgtccgaggcaggggcctggcagctcgaataa

DBGET integrated database retrieval system