KEGG   Serratia fonticola: Z042_08830Help
Entry
Z042_08830        CDS       T02987                                 

Definition
4-aminobutyrate aminotransferase (EC:2.6.1.19)
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sfo  Serratia fonticola
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sfo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Z042_08830
   00650 Butanoate metabolism
    Z042_08830
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Z042_08830
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Z042_08830
Enzymes [BR:sfo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Z042_08830
Amino acid related enzymes [BR:sfo01007]
 Aminotransferase (transaminase)
  Class III
   Z042_08830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(1954881..1956146)
Genome map
AA seq 421 aa AA seqDB search
MKNAELNQRRLAATPRGIGVMCGFYAERAENATLWDVEGNEVIDFAAGIAVLNTGHRHPK
VIAAIEKQLNAFTHTAYQIVPYESYIALAERINQRAPIEGACKTAFFTTGAEAVENAVKI
ARAYTGRPGVITFGGGFHGRTYMTMALTGKVAPYKLGFGPFPGSVFHGQYPNALYGVSTE
DAMNSLERIFKADIDAKQVAAIVLEPVQGEGGFNIAPPEFMQALRALCDQQGILLIADEV
QTGFARTGTLFAMEHYTVKPDLITMAKSLAGGMPLSAVAGRAEVMDAPAPGGLGGTYAGN
PLAVASALAVLEVIEEEQLCQRSQRLGQHLVEVLQQARKHCPAIADIRAKGSMVAVEFND
PATGKPSPEFTRQVQQKAQEEGLLLLSCGVNGNVIRFLYPLTIPDAQFNQALAILSRALV
H
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcagaactgaatcaacgtcgtctggctgccaccccgcgtggcattggtgtg
atgtgtggtttttacgcagagcgggcagaaaatgccacgttgtgggatgtggaagggaat
gaggtcatcgattttgctgcgggtattgccgtgctcaataccggccaccgccacccgaaa
gtgattgctgcgattgaaaagcagctcaacgcttttactcataccgcttatcaaatcgtc
ccttatgaaagctatattgcgctggcagagcgtatcaaccagcgcgcgcctattgaaggg
gcttgtaaaaccgcctttttcaccaccggagcagaagcggtagagaacgcggtgaaaatt
gcccgtgcttatactggccgcccaggggtgatcaccttcggcggtggtttccatggccgt
acctacatgacgatggctttgaccggcaaagtggcaccttacaaactggggtttggcccg
ttccctggttcggtgttccatggccagtatccaaatgcgctgtatggcgtgagtaccgaa
gacgccatgaacagcctggagcgtatttttaaagccgatatcgatgccaaacaggtggcg
gcgattgtgctggaaccggtgcagggggaaggcggtttcaatattgcgccgcctgaattt
atgcaggcgttgcgtgcgctgtgcgatcaacagggtattctgttgatcgctgatgaagtg
cagaccggttttgcgcgtaccggtacgctgtttgcgatggaacactacacagtaaaaccc
gatctgatcaccatggcgaaaagcctggcaggggggatgccgctatcggcggtggcgggc
cgtgccgaggtgatggatgctccggctccaggggggctgggtggcacttatgctggtaat
ccactggccgttgcttcggcattagccgtgttggaggtgatcgaagaagagcaactatgc
cagcgctcgcagcgcttgggccagcatttggtggaagtgctacagcaggcgcgcaaacat
tgcccggcaattgccgatattcgtgccaagggttcgatggtggccgtggagttcaacgat
ccagccaccggcaaaccgtcgccggaatttactcgtcaggtacaacaaaaagctcaagag
gaagggttattgctgctgagctgcggtgtgaatggcaacgttattcgcttcctttacccg
ctgaccattcctgatgcccagttcaaccaggcactggcaatcctttcccgtgcgctggtt
cattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system