KEGG   Shewanella frigidimarina: Sfri_2181Help
Entry
Sfri_2181         CDS       T00395                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sfr  Shewanella frigidimarina
Pathway
sfr03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sfri_2181
Enzymes [BR:sfr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Sfri_2181
DNA repair and recombination proteins [BR:sfr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Sfri_2181
    RecFOR pathway proteins
     Sfri_2181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH IMS_HHH HHH_3 HHH_8 5_3_exonuc
Motif
Other DBs
NCBI-ProteinID: ABI72027
JGI: Sfri2181
UniProt: Q081N8
Position
complement(2607789..2608406)
Genome map
AA seq 205 aa AA seqDB search
MIGRLSGILVEKQAPEVVLDVNGVGYELQVPMTSFYELPALNQAAMLFTHFVVREDAQLL
YGFITKQERALFRLLIKTNGVGPKLALTILSGMTASEFVSCVERDDIATLVKLPGVGKKT
AERLVIEMRDKLKSLLEASAGSEREFMLQSNYTPAAAVDSAEEDAISALLSLGYKPAQAS
KSVSAAFKEGMSSETLIKAALKSML
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgataggtcgtctaagcggaatattagtagaaaagcaagcgcctgaagtggtgcttgat
gtcaatggcgtcggttatgagttacaagtgccgatgaccagcttttatgaattaccagcg
ttaaaccaagctgctatgttatttactcattttgtggtgcgtgaagatgctcagctactt
tacggttttatcactaaacaagaacgtgcattattccgtttattgattaaaaccaatggc
gttgggcctaaactggcattaactattttgtcgggtatgacagcgtctgagttcgtgtca
tgtgttgaacgtgatgatattgcgactttagtaaaactgcctggcgttggtaagaaaacc
gcagagcgtttggtgattgaaatgcgtgataagcttaaaagcttacttgaagcttctgca
ggttcagagcgcgagtttatgctgcaaagtaattatactccagcagcggctgttgatagt
gcagaagaagatgccatttcagctttattgtcattaggttataaacctgctcaggccagt
aagtcagtttctgcggcttttaaagaaggcatgagttcagaaacgctaattaaagctgca
ttaaaatcaatgctataa

DBGET integrated database retrieval system