KEGG   Shigella flexneri 2457T (serotype 2a): S1937Help
Entry
S1937             CDS       T00128                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sfx00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    S1937 (ruvA)
Enzymes [BR:sfx01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     S1937 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1878434..1879045)
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGIIIEKQPPLVLIEVGGVGYEVHMPMTCFYELPEAGQEAIVFTHFVVREDAQLL
YGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVNAVEREEVGALVKLPGIGKKT
AERLIVEMKDRFKGLHGDLFTPAADLVLTSPASPATDDAEQEAVAALVALGYKPQEASRM
VSKIARPDTSSETLIREALRAAL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactcagaggcatcatcattgaaaaacaacccccgctggtgttaattgaa
gtgggcggcgtaggctatgaagtgcatatgccgatgacctgtttttatgaactccctgaa
gcgggtcaggaagcgatcgttttcacccactttgtggtgcgtgaagacgcgcaactgctg
tacggttttaacaataaacaagaacgcacgttgttcaaagagttgatcaaaaccaacggc
gtcggcccgaagttggccctggcgatcctctccggaatgtcagcgcagcagttcgttaat
gccgttgagcgtgaagaagtgggggcactggtgaaactgccgggtattggcaaaaaaacc
gccgaacgcttgattgttgaaatgaaagaccgatttaaaggtttgcatggcgatctcttt
acgccagccgccgacctggtactcacgtctcctgctagcccggcgaccgacgatgctgaa
caagaagcagttgccgcgctggtggcgctaggctataaaccacaagaagcaagccgcatg
gtgagcaaaatcgctcgccctgacaccagcagtgaaacattaattcgcgaagccctacgc
gccgcgttatga

DBGET integrated database retrieval system