KEGG   Streptomyces griseus: SGR_5380Help
Entry
SGR_5380          CDS       T00691                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
sgr  Streptomyces griseus
Brite
Enzymes [BR:sgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     SGR_5380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(6329353..6330219)
Genome map
AA seq 288 aa AA seqDB search
MSVRSRTVKSSVKHSPRCPSAPSDEQETLVPVLPGAEPFRHEGGEVGVLLCHGFTGSPQS
LRPWADYLAERGLTVSLPLLPGHGTRWEDMAVTGWQDWYAEVDRELRVLRETCERVFVFG
LSMGGALSLRLAAKHGEAISGLVLVNPANKVHGLSAYALPVARHLVRTTKGLADDIALPG
SHEVGYDRVPLHAAHSVRRFFRLVDGELPQVTQPVVLLHSPQDHVVPPADSARILSRISS
TDVSEILLEQSYHVATLDHDAERIFDESYRFIGRLAPSVGMKGSTSGG
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggtccggtcgcgtacggtgaagtcatccgtcaagcactcccccaggtgcccgtcc
gccccgtccgacgaacaggagaccctggtgccggtcctccctggagccgagccgttccgc
cacgagggcggagaggtcggcgtcctcctctgtcatggcttcaccggatccccgcagtcg
ctgcgcccctgggcggactatctcgccgagcgcgggctgacggtctcgctgccgctgctg
ccgggccacgggacccgctgggaggacatggcggtcaccggctggcaggactggtacgcg
gaggtggaccgggagctgcgggtcctccgggagacgtgcgagcgcgtcttcgtcttcgga
ctctccatgggcggcgccctgtccctgcggctcgcggccaagcacggggaggcgatcagc
ggtctggtgctggtcaacccggccaacaaggtgcacggcctctcggcgtacgcgctgccg
gtggcccgtcatctggtgcggacgacgaagggtctggccgacgacatcgcgctcccgggc
tcgcacgaggtgggctacgacagggtgccgctgcacgccgcgcactcggtgcggaggttc
ttccggctggtcgacggggagctgccccaggtgacccagccggtggtcctgctgcacagc
ccgcaggaccatgtcgtgccgcccgcggacagcgcccggatcctgagccggatctcctcc
acggacgtctcggagatcctgttggaacagagctaccacgtggcgacgttggaccatgat
gcggagcggatcttcgatgagagctaccggttcatcggccgtctcgcaccgagcgtcggg
atgaaggggagcacgtccggtggctga

DBGET integrated database retrieval system