KEGG   Shewanella sp. MR-4: Shewmr4_1726Help
Entry
Shewmr4_1726      CDS       T00388                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
she  Shewanella sp. MR-4
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:she00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Shewmr4_1726
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Shewmr4_1726
Enzymes [BR:she01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Shewmr4_1726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2051873..2052901
Genome map
AA seq 342 aa AA seqDB search
MSYLMLDLLSLDVSEAEAEMLRHPQVGGLILFSRNFSSREQLIALVQQIRQIRPEILIAV
DHEGGRVQRFREGFTLIPAMGDILPAAKGDMVLAKRWACELGFLMAIELLACDIDLSFAP
VLDLNGISQVIGKRSFSAKPDEVIALAQSFIEGMAEAGMGAVGKHFPGHGSVAADSHIAQ
PIDEREAEAIFNQDILPFKELIAKGKLSGIMPAHVIYPKVDPNPAGFSSYWLKQILRKEL
GFNGVIFSDDLGMKGAAFAGDYLGRAQAALDAGCDMILVCNDNPGVMSLLNGFVWPAAAP
QHPASLLKPNAAQTAIALENASRWENAKQLAEQIQLAQQAKV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagttatctaatgttggatctgctgtctttagatgttagcgaagctgaagccgagatg
ctgcgccatccgcaggtgggtggtttgatcctgttttcccgcaatttttccagccgtgag
cagttaattgccttagtgcaacagatccgccaaattcgtcccgagattttgattgccgtt
gaccatgagggcgggcgagtacagcgtttccgtgaaggatttaccctgatcccggccatg
ggggatattttgcccgcggctaagggcgatatggttcttgctaaacgttgggcctgtgaa
ttaggctttttaatggctatcgaattactcgcctgtgacatcgacttaagttttgcgcct
gtgctcgatcttaacggcatcagccaagtcattggtaaacgtagttttagcgcaaagccc
gatgaagtgattgcgttagcgcagagttttattgagggtatggccgaggcaggcatgggc
gctgtgggtaagcatttccccggtcatggtagcgtggcggcggactcccatatcgcgcaa
cctatcgatgagcgtgaagctgaggcgatttttaatcaagatattttgccatttaaagaa
ctgattgctaagggtaaattatcgggcattatgccagcccatgtcatttaccctaaagtt
gaccctaatcctgcgggcttttcaagctactggttaaagcagatcctacgcaaagagctg
ggctttaacggggtgattttctccgacgatctggggatgaagggcgctgcctttgcagga
gattatttaggccgtgcccaagctgcgttggatgcgggctgcgatatgattttggtctgt
aacgataatccgggcgttatgtcactgttaaatggctttgtgtggcccgccgcggcgcca
caacatcctgcgagtttactcaaacccaatgcagcgcagacagctatcgcattagaaaat
gctagccgttgggaaaatgccaagcagctggctgagcaaatccaactcgcacaacaggca
aaagtttga

DBGET integrated database retrieval system