KEGG   Sphingobacterium sp. 21: Sph21_2153Help
Entry
Sph21_2153        CDS       T01450                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
shg  Sphingobacterium sp. 21
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Sph21_2153
Enzymes [BR:shg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Sph21_2153
    3.5.1.-  
     Sph21_2153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2641663..2642253
Genome map
AA seq 196 aa AA seqDB search
MKALIIIDIQLDFLPGGALAVERGDEVIPIINELQSSYELVVATQDWHPANHKSFFTEHT
GKQAFERIQWNGLEQVLWPVHCVQGTAGAALAPKLSTNAVEAIFRKGMDQNIDSYSGFFD
NGRKKATGMADYLKGRGITEVAVCGLAADYCVYYTANDALDLGFKAGIIEHASRAIDLER
YQRLKLDFQEKGGQIL
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactaattattatcgatatacaactcgattttttgccgggaggcgctcttgca
gtggaacgaggggacgaagttattccaattatcaatgaattgcaatcgtcttacgagtta
gtggtagctacacaggattggcatccggcaaatcataaaagtttctttacggaacatacg
ggaaagcaggcttttgaacgaattcaatggaatggcttggagcaagtgctttggccggta
cactgtgtacagggaacagcgggagcggccttagcgccgaaactgtcaacgaatgcggtt
gaagctatttttagaaagggcatggatcaaaatattgatagctacagcggtttttttgat
aacggcagaaagaaggctaccggtatggctgattacctgaagggtcgagggattacggag
gtggccgtctgcggcttagccgcagactattgtgtttattataccgctaatgacgctttg
gatctgggatttaaagctggtattattgaacacgcctcccgtgccattgatctggaacga
tatcaacggctgaagctcgatttccaagaaaaaggaggacagattttataa

DBGET integrated database retrieval system