KEGG   Sphingobacterium sp. 21: Sph21_2153Help
Entry
Sph21_2153        CDS       T01450                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
shg  Sphingobacterium sp. 21
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:shg00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2641663..2642253
Genome map
AA seq 196 aa AA seqDB search
MKALIIIDIQLDFLPGGALAVERGDEVIPIINELQSSYELVVATQDWHPANHKSFFTEHT
GKQAFERIQWNGLEQVLWPVHCVQGTAGAALAPKLSTNAVEAIFRKGMDQNIDSYSGFFD
NGRKKATGMADYLKGRGITEVAVCGLAADYCVYYTANDALDLGFKAGIIEHASRAIDLER
YQRLKLDFQEKGGQIL
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactaattattatcgatatacaactcgattttttgccgggaggcgctcttgca
gtggaacgaggggacgaagttattccaattatcaatgaattgcaatcgtcttacgagtta
gtggtagctacacaggattggcatccggcaaatcataaaagtttctttacggaacatacg
ggaaagcaggcttttgaacgaattcaatggaatggcttggagcaagtgctttggccggta
cactgtgtacagggaacagcgggagcggccttagcgccgaaactgtcaacgaatgcggtt
gaagctatttttagaaagggcatggatcaaaatattgatagctacagcggtttttttgat
aacggcagaaagaaggctaccggtatggctgattacctgaagggtcgagggattacggag
gtggccgtctgcggcttagccgcagactattgtgtttattataccgctaatgacgctttg
gatctgggatttaaagctggtattattgaacacgcctcccgtgccattgatctggaacga
tatcaacggctgaagctcgatttccaagaaaaaggaggacagattttataa

DBGET integrated database retrieval system