KEGG   Shewanella putrefaciens 200: Sput200_2292Help
Entry
Sput200_2292      CDS       T02015                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
shp  Shewanella putrefaciens 200
Pathway
shp00020  Citrate cycle (TCA cycle)
shp00640  Propanoate metabolism
shp00660  C5-Branched dibasic acid metabolism
shp01100  Metabolic pathways
shp01110  Biosynthesis of secondary metabolites
shp01120  Microbial metabolism in diverse environments
shp01130  Biosynthesis of antibiotics
shp01200  Carbon metabolism
Module
shp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
shp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sput200_2292
   00640 Propanoate metabolism
    Sput200_2292
   00660 C5-Branched dibasic acid metabolism
    Sput200_2292
Enzymes [BR:shp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Sput200_2292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ADV54739
UniProt: E6XNW9
Position
complement(2612298..2613464)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKSLFAEYGLPVSEGFACDTAQEAVEAAGRIGGNLWVVKCQVHAGGRGKAGGV
KVTGDKEEIRAFAEHWLGKNLVTYQTDEKGQPVAKILVESCTDIANELYLGAVVDRSTRR
VVFMASTEGGVEIEKVAEETPELIHKAIIDPLTGPQPYQARDLGFKLGLNPTQMKQFTKI
FMGLATMFVDHDFALLEINPLVITTEGNLHCLDGKIGIDGNALFRQPKVKAMHDPSQDDA
REAHAAMFELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVAE
AFKIILSDSNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGTNAELGREV
LAKSGLDIIAATSLTDAAERVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgagtatcaggcaaaatccctatttgccgaatatggtttaccagtgtca
gaaggttttgcatgtgatacagcccaagaagctgtagaagcggcaggccgtattggcgga
aatttatgggttgttaagtgtcaagtacacgctggcggccgcggtaaagcgggtggcgtt
aaagtcactggcgataaagaagaaatcagagcctttgccgaacactggttaggcaaaaat
ctggtgacttatcaaacagatgagaaaggccagcccgttgctaaaattttagtagaaagc
tgcaccgacatcgctaacgaactgtacttaggcgcagtcgttgaccgtagcacacgccgc
gtcgtgtttatggcgtcaactgaaggcggtgttgaaattgagaaagtggcagaagaaacg
ccagaactcattcacaaagcgattatcgatccgctaacaggcccacagccatatcaagcc
cgtgatcttggcttcaaactgggtttgaatccaactcaaatgaaacagttcactaagatc
tttatgggtctggcgacgatgttcgttgatcacgattttgcgctacttgaaatcaaccca
ctggttatcaccactgaaggtaacctgcactgcctagacggtaaaattggtatcgatggt
aacgcactgttccgtcagccaaaagttaaagcaatgcacgacccatcacaggatgacgcc
cgtgaagcccatgcagcgatgttcgaactgaactatgtggcattagacggtaacgttggc
tgtatggtgaacggtgcagggcttgctatgggtacgatggacatcgttaacctgcacggt
ggcaagccagcaaacttcctcgacgtaggcggcggtgcgactaaagaacgtgttgctgaa
gcgtttaaaatcattctgtctgacagcaatgtgaaagcggttctggttaacatcttcggt
ggtatcgtacgttgtgacatgatcgctgaaggtattattggcgccgttaaagaagtgggc
gttaaggttccagttgtggtgcgtttagaaggtactaacgctgaattaggccgtgaagtt
ctggcaaaatctggtcttgatatcattgcagctaccagtctgactgatgcggctgaacga
gtagttaaagctgcggagggcaaataa

DBGET integrated database retrieval system