KEGG   Shewanella putrefaciens 200: Sput200_2292Help
Entry
Sput200_2292      CDS       T02015                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
shp  Shewanella putrefaciens 200
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sput200_2292
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sput200_2292
   00640 Propanoate metabolism
    Sput200_2292
   00660 C5-Branched dibasic acid metabolism
    Sput200_2292
Enzymes [BR:shp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Sput200_2292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2612298..2613464)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKSLFAEYGLPVSEGFACDTAQEAVEAAGRIGGNLWVVKCQVHAGGRGKAGGV
KVTGDKEEIRAFAEHWLGKNLVTYQTDEKGQPVAKILVESCTDIANELYLGAVVDRSTRR
VVFMASTEGGVEIEKVAEETPELIHKAIIDPLTGPQPYQARDLGFKLGLNPTQMKQFTKI
FMGLATMFVDHDFALLEINPLVITTEGNLHCLDGKIGIDGNALFRQPKVKAMHDPSQDDA
REAHAAMFELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVAE
AFKIILSDSNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGTNAELGREV
LAKSGLDIIAATSLTDAAERVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgagtatcaggcaaaatccctatttgccgaatatggtttaccagtgtca
gaaggttttgcatgtgatacagcccaagaagctgtagaagcggcaggccgtattggcgga
aatttatgggttgttaagtgtcaagtacacgctggcggccgcggtaaagcgggtggcgtt
aaagtcactggcgataaagaagaaatcagagcctttgccgaacactggttaggcaaaaat
ctggtgacttatcaaacagatgagaaaggccagcccgttgctaaaattttagtagaaagc
tgcaccgacatcgctaacgaactgtacttaggcgcagtcgttgaccgtagcacacgccgc
gtcgtgtttatggcgtcaactgaaggcggtgttgaaattgagaaagtggcagaagaaacg
ccagaactcattcacaaagcgattatcgatccgctaacaggcccacagccatatcaagcc
cgtgatcttggcttcaaactgggtttgaatccaactcaaatgaaacagttcactaagatc
tttatgggtctggcgacgatgttcgttgatcacgattttgcgctacttgaaatcaaccca
ctggttatcaccactgaaggtaacctgcactgcctagacggtaaaattggtatcgatggt
aacgcactgttccgtcagccaaaagttaaagcaatgcacgacccatcacaggatgacgcc
cgtgaagcccatgcagcgatgttcgaactgaactatgtggcattagacggtaacgttggc
tgtatggtgaacggtgcagggcttgctatgggtacgatggacatcgttaacctgcacggt
ggcaagccagcaaacttcctcgacgtaggcggcggtgcgactaaagaacgtgttgctgaa
gcgtttaaaatcattctgtctgacagcaatgtgaaagcggttctggttaacatcttcggt
ggtatcgtacgttgtgacatgatcgctgaaggtattattggcgccgttaaagaagtgggc
gttaaggttccagttgtggtgcgtttagaaggtactaacgctgaattaggccgtgaagtt
ctggcaaaatctggtcttgatatcattgcagctaccagtctgactgatgcggctgaacga
gtagttaaagctgcggagggcaaataa

DBGET integrated database retrieval system