KEGG   Shewanella putrefaciens 200: Sput200_3642Help
Entry
Sput200_3642      CDS       T02015                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
shp  Shewanella putrefaciens 200
Pathway
shp00230  Purine metabolism
shp01100  Metabolic pathways
Module
shp_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Sput200_3642
Enzymes [BR:shp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Sput200_3642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 MMR_HSR1 RsgA_GTPase AAA_33 AAA_22 ABC_tran Peptidase_M28 AAA_29 cobW
Motif
Other DBs
NCBI-ProteinID: ADV56022
UniProt: E6XQV6
Position
4146443..4147066
Genome map
AA seq 207 aa AA seqDB search
MTARGNLFIVSAPSGAGKSSLISALLKDKPADMQVSVSHTTRAPRPGEVDGQHYHFVNVE
QFKTLIAENAFFEWAEVFGNYYGTSRHVIEHTLTQGIDVFLDIDWQGAEQVKAVMPEAVG
VFILPPSKAELERRLTGRGQDSQEVIASRMAQAVSEMSHYKEYDFIIINDDFDTALADLR
AIIRSQRLTGASQIHAQNDMLHDLLAG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgcggaaatttatttattgtgtcagcgccaagtggtgcgggtaaatcctcg
ctaatttcggcattgttaaaagacaaacctgccgatatgcaggtttcagtatcacatact
acccgcgcgccgcgcccaggtgaagttgatggccaacactaccacttcgttaatgttgaa
caatttaaaacattaatagctgaaaatgcctttttcgaatgggctgaagtattcggtaat
tactatggcacatcacgccatgtgatcgaacatacgctcacccaaggtatcgatgtgttc
ctcgatatcgactggcaaggtgccgagcaggttaaagcggttatgcctgaagccgtaggg
gtatttattttaccgccctcgaaagctgaactagagcgacgcctgactggtcgaggacaa
gacagtcaggaagtgattgccagccgaatggcacaagcggtatcggaaatgtcccactat
aaagaatatgattttattatcatcaatgatgattttgatacagcactggccgatctgcgt
gccatcattcgcagccaacgcttaacaggtgctagtcagatccacgcacaaaatgatatg
cttcacgatctgttggcaggatag

DBGET integrated database retrieval system