KEGG   Sarcophilus harrisii (Tasmanian devil): 100917850Help
Entry
100917850         CDS       T02286                                 

Gene name
PPT1
Definition
palmitoyl-protein thioesterase 1
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:shr01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:shr00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:shr04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 256 aa AA seqDB search
MGAIKKLVELKIPGIYVLSLEIGKTLIEDMENSFFLNVNHQVSLVCEMLAQNPKLQQGYN
AMGFSQGGQFLRAVAQRCPSPPMINLISVGGQHQGVYGLPRCPGESSHICDWLRKTLNVG
AYTKGVQERLVQAEYWHDPIKEEIYRNSSIFLADINQERGINETYRKNLMALKNFVMVKF
LNDSVVDPVDSEWFGFYRSGQAKETEPLQDTALYTEDRLGLKEMDKAGKLIFLAVEGDHL
QFSEQWFCTSLLPFLV
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgggggccattaaaaaattggttgagctcaaaataccaggaatttatgtgttatcattg
gagattgggaagactctgattgaggatatggagaacagcttcttcttaaacgtgaatcac
caggtgtctctggtgtgtgagatgctcgcccagaaccccaagctgcagcagggctacaac
gccatgggcttctcccaaggtggccagttcctgagggcagtggcgcagagatgtccgtca
cctcccatgatcaatctgatttccgtgggtggacagcatcaaggtgtgtacgggctgcct
cgatgtccaggggagagctctcacatttgtgactggctcaggaaaacgctgaacgtgggc
gcctacaccaagggtgtccaggaacgcttggtccaagcagagtactggcacgaccccata
aaggaggagatctaccgcaacagcagcatcttcttggccgacatcaaccaggagaggggc
atcaatgagacctaccggaagaatctgatggccctgaagaattttgtgatggtgaagttc
ctcaatgactcggtggtggaccccgtggattccgagtggtttggattttaccggagtggc
caagccaaggagactgagcccctgcaggacactgccctgtacacagaggaccgcttgggg
cttaaggaaatggacaaagcaggcaaactaatcttcctggctgtagagggggaccacctt
caattctcggagcagtggttttgtacaagtctcctcccattcttggtgtga

DBGET integrated database retrieval system