KEGG   Sarcophilus harrisii (Tasmanian devil): 100917850Help
Entry
100917850         CDS       T02286                                 

Gene name
PPT1
Definition
(RefSeq) palmitoyl-protein thioesterase 1
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00062  Fatty acid elongation
shr01100  Metabolic pathways
shr01212  Fatty acid metabolism
shr04142  Lysosome
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    100917850 (PPT1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100917850 (PPT1)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     100917850 (PPT1)
Lipid biosynthesis proteins [BR:shr01004]
 Fatty acid synthase
  Component type
   100917850 (PPT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest Glyco_hydro_98M
Motif
Other DBs
NCBI-GeneID: 100917850
NCBI-ProteinID: XP_003765457
Ensembl: ENSSHAG00000002339
Position
3
AA seq 308 aa AA seqDB search
MALPKLLILLLSAALFPWPSPSSGAPLTGPRKEPPPLVIWHGMGDSCCNPLSMGAIKKLV
ELKIPGIYVLSLEIGKTLIEDMENSFFLNVNHQVSLVCEMLAQNPKLQQGYNAMGFSQGG
QFLRAVAQRCPSPPMINLISVGGQHQGVYGLPRCPGESSHICDWLRKTLNVGAYTKGVQE
RLVQAEYWHDPIKEEIYRNSSIFLADINQERGINETYRKNLMALKNFVMVKFLNDSVVDP
VDSEWFGFYRSGQAKETEPLQDTALYTEDRLGLKEMDKAGKLIFLAVEGDHLQFSEQWFC
TSLLPFLV
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggctctccccaagttgttaatcctgctgctgagcgcggcgctcttcccatggccctct
ccgagctccggtgctccactgacggggccgcggaaggagccgccgcccctggtcatttgg
cacgggatgggagacagctgctgtaaccctttgagtatgggggccattaaaaaattggtt
gagctcaaaataccaggaatttatgtgttatcattggagattgggaagactctgattgag
gatatggagaacagcttcttcttaaacgtgaatcaccaggtgtctctggtgtgtgagatg
ctcgcccagaaccccaagctgcagcagggctacaacgccatgggcttctcccaaggtggc
cagttcctgagggcagtggcgcagagatgtccgtcacctcccatgatcaatctgatttcc
gtgggtggacagcatcaaggtgtgtacgggctgcctcgatgtccaggggagagctctcac
atttgtgactggctcaggaaaacgctgaacgtgggcgcctacaccaagggtgtccaggaa
cgcttggtccaagcagagtactggcacgaccccataaaggaggagatctaccgcaacagc
agcatcttcttggccgacatcaaccaggagaggggcatcaatgagacctaccggaagaat
ctgatggccctgaagaattttgtgatggtgaagttcctcaatgactcggtggtggacccc
gtggattccgagtggtttggattttaccggagtggccaagccaaggagactgagcccctg
caggacactgccctgtacacagaggaccgcttggggcttaaggaaatggacaaagcaggc
aaactaatcttcctggctgtagagggggaccaccttcaattctcggagcagtggttttgt
acaagtctcctcccattcttggtgtga

DBGET integrated database retrieval system