KEGG   Sarcophilus harrisii (Tasmanian devil): 100919394Help
Entry
100919394         CDS       T02286                                 

Definition
hexosaminidase D-like
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100919394
Enzymes [BR:shr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     100919394
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 623 aa AA seqDB search
MRRPEDIDGESSGESDGGDRTVEGVTTPPRMLQRNQKLLLQVASLLLCACAGLRLLLPRC
LEPTSGRPWGEAGGVQPSPEPVGESTLGSWSQRLTGEVPRRDQTGVMKVVHLDMKGAAPR
VSYLEQLFPLLSRLGADAVLIEYEDMFPFHGELELLRSPHSYSKHDIERIQQLATQNHLE
VIPLVQTFGHFEFVLKHEKFWPLREVDRYPSTLNPHAAGTMPLLRALLGQVLDQHPHTRW
LHVGADEVFHLGEGADSRAWLLRHGEDVGHMYLNHVREVVTFLSWRHPGLRLLLWDDVLR
RLPPQAVQESGIPQLADPMMWFYDPDLDTDQIGRIIAKYAESGFRSVWFASSFKGSTGPA
QMWTPLSHHLSNQLSWLRVLRALQAASSGPHIRDARPIRCQGIVLTGWQRYDHYSVLCEL
LPVAVPSLAICLQTLVAGEFTEVTKKTVMELLGFQTINLESSTCQGDGMFPGAEVYHLVE
QVKELKENGLRALEEDSTAQGWFSPYHRKNHFGNPQNLEAFGRKLTKVSEAWESLLPTLQ
MHLGVVFYSNTVDEWLEEYVLPQLEPLRAMVRDYQELLQLKGKPGGARPGEVVLNPPAIP
TPGPGFRGPRSRRESPGDGSFGG
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgagaagaccggaggatatagacggggaaagttctggggagagtgatggaggagatagg
acggtggaaggagtaactacaccccccaggatgttgcaaaggaaccagaaattgcttctg
caagtggcctccttgctcctctgtgcttgtgccggcctcagactgcttctgccccggtgt
ctggagccaacatcaggcaggccctggggtgaggcagggggtgtccagccatctcctgaa
ccagttggggagagcactctgggctcttggtctcagaggttgaccggggaagttcctcga
agagatcaaacaggagtgatgaaagttgtccatctggacatgaaaggagctgctcccagg
gtatcttatctggaacagctgtttccacttctgtctcggcttggggcagatgctgtgctg
atcgaatatgaagacatgtttcctttccatggggaactggagttgttacgttcaccccac
tcctacagtaaacatgacattgagcggattcagcaattggcaacacagaaccatctggag
gtgattcccctggtgcagacatttggccactttgagtttgtgctaaaacacgagaagttc
tggccccttcgggaggtggatcgttatcccagcaccctgaatccacatgctgctgggaca
atgccgttactccgagccctcctgggccaggtccttgaccagcacccacatacccgctgg
ttacatgtgggagctgatgaggtgttccacctgggtgagggtgcagactcccgagcctgg
ttacttcgccatggcgaagatgttggccacatgtacttgaaccatgttcgagaagtcgtg
acttttctgagctggcgccacccagggcttcgactactactttgggatgatgtgcttcga
agactaccaccccaggccgtccaagaatcagggatccctcagcttgcagaccctatgatg
tggttctatgaccctgacttggacactgaccagattggacgcatcattgccaagtatgca
gaaagtggcttccgaagcgtgtggtttgccagttccttcaagggttccacaggcccagcc
cagatgtggacacctcttagccatcacctgagcaaccagctgtcgtggcttcgtgtgctc
cgagctctgcaggctgcatcttctggcccccacatccgggatgcccgtcctatccgttgc
cagggcattgttctgaccggttggcagagatatgaccactattctgtgctgtgtgagctg
ctcccggtggctgttccttccctggccatctgtctgcagacccttgttgctggagaattc
actgaggtgaccaagaagacagttatggagctgctgggatttcagactatcaacttggag
tccagcacatgccaaggagatggtatgtttcctggggctgaagtctaccacctggtagaa
caagtcaaggagctgaaggagaatggactgagagctctggaggaggatagcacagctcag
ggctggttcagcccttaccatcgcaaaaatcactttgggaatccacagaatctggaggcc
tttggccgaaaattgaccaaggtgtccgaagcctgggagagcctgctgccaaccctacag
atgcatttgggtgttgtgttctactctaatactgtggatgagtggttggaggagtatgtg
ttaccccagctagaacccttgagggctatggttcgggattaccaggagctcctccagctg
aaagggaaacctgggggggcccggcctggggaagttgtgctgaatcccccagccatccca
accccaggccctggcttccggggtccccgttccaggagggagagtccaggtgatggctca
tttgggggctga

DBGET integrated database retrieval system