KEGG   Sarcophilus harrisii (Tasmanian devil): 100919815Help
Entry
100919815         CDS       T02286                                 

Gene name
ASPG
Definition
asparaginase homolog (S. cerevisiae)
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 506 aa AA seqDB search
MARSGDPVRRLLAIYTGGTIGMRNQDGILVPGSNLFTALKKLPMFNDEEYSREHQLPEDT
LALPLTDHNQRIIYTILEYDPLFDSSDMTINEWIRIAKDIERNYEQYFGFVIIHGTDTMA
FASSMLSFILGNLQKTVILTGAQVPIHTLWNDGRENLLGSLLMAGQYVIPEVCLFFQNQL
YRGNRVTKVDSQRFAAFCSPNLPPLANVGADITVNHDIILKASMNKQLVVHSNMERNVGV
LRLYPGITSAMVKAFLQAPMKGVVMETFGTGNGPTNPDLLWELKKATERGIVIVNCTHCL
QGSVTSNYAAGMALSGIGIVPGSDMTSEAALAKLSYVLGRDDLDLQYKSKLLTKNLRGEM
TPLSEDFQISLRDSKFVQLIANLLYLNCSHDLDAVRDSLTPTLACAAARMGDMETLEAIF
ELGGDLSESDFDGRTPLHMAARGGHVGTVQYLLRNGAKVNSCDGDRNSPLLIAVKGRHRD
VIQLLKDAGAHLSPQELQGAGTELCR
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggtcgggggatcctgtgcggaggctcttagccatctacaccggaggcaccatc
ggcatgcggaaccaggacggcattctagttcctggaagcaatttgttcactgctctgaaa
aagctacccatgtttaatgatgaggaatactctcgagaacaccagctaccagaagatact
ctggcccttcccctcaccgaccataaccagcggattatatataccatcctggaatatgac
ccactttttgactccagtgacatgacaattaacgagtggattagaattgcaaaggacatt
gagaggaattatgagcagtattttggctttgtaatcatccacggcacagacaccatggcc
tttgcttcctccatgctctcttttattttagggaatcttcagaaaactgtcatcctcacg
ggtgctcaggtccccattcatactctttggaatgatggccgggagaacctgctcggtagc
ctgctcatggctggacagtatgtgattccagaggtctgcctcttctttcaaaaccagctc
taccgggggaaccgggtaacaaaggtggattctcaacggtttgcagccttctgctcaccc
aacctgcctccacttgccaatgttggtgctgatatcacagtcaaccatgacatcatattg
aaggccagtatgaacaaacaactcgtggtacacagcaacatggagagaaatgttggcgtc
cttcggctctatcctggaattacttccgccatggtgaaggccttcctacaggcccccatg
aagggggtggtgatggagacttttggcacaggcaacggacccaccaatcctgatctgctt
tgggagttgaagaaagccacagagaggggaatagtcattgtcaattgtacccactgctta
cagggttctgtgacttcaaactacgcagctggcatggctctatcaggtattggtatcgtc
cctgggtccgatatgacatctgaggcagcactggccaaactctcctatgtgctgggcagg
gatgatctcgacctgcagtacaagagcaagctactgaccaagaacttgaggggagagatg
actcccctctctgaagatttccagatatcacttcgggatagcaaatttgtccagcttatt
gccaacctcctctacctgaactgcagccacgaccttgatgctgtaagggactctctgact
cctaccttggcctgtgctgcagcccgaatgggggacatggagaccctggaagccatcttc
gaactgggtggagatctgagtgagagtgactttgatggccgtactcccctgcacatggct
gcccgaggtgggcatgtgggtactgtccagtaccttctgaggaatggggcaaaggtgaac
agctgcgatggtgacaggaacagcccgctgttgatagcagtgaagggcaggcacagagat
gtcatccagctcctcaaggatgcaggtgctcatctatctcctcaagagcttcagggtgca
gggactgagctctgcaggtaa

DBGET integrated database retrieval system