KEGG   Sarcophilus harrisii (Tasmanian devil): 100928990Help
Entry
100928990         CDS       T02286                                 

Gene name
MAPK11
Definition
mitogen-activated protein kinase 11
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
MAPK signaling pathway
Rap1 signaling pathway
FoxO signaling pathway
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Osteoclast differentiation
Platelet activation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Retrograde endocannabinoid signaling
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Prolactin signaling pathway
Amyotrophic lateral sclerosis (ALS)
Salmonella infection
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Influenza A
Epstein-Barr virus infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100928990 (MAPK11)
   04010 MAPK signaling pathway
    100928990 (MAPK11)
   04370 VEGF signaling pathway
    100928990 (MAPK11)
   04668 TNF signaling pathway
    100928990 (MAPK11)
   04068 FoxO signaling pathway
    100928990 (MAPK11)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100928990 (MAPK11)
   04620 Toll-like receptor signaling pathway
    100928990 (MAPK11)
   04621 NOD-like receptor signaling pathway
    100928990 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    100928990 (MAPK11)
   04660 T cell receptor signaling pathway
    100928990 (MAPK11)
   04664 Fc epsilon RI signaling pathway
    100928990 (MAPK11)
   04670 Leukocyte transendothelial migration
    100928990 (MAPK11)
  Endocrine system
   04912 GnRH signaling pathway
    100928990 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    100928990 (MAPK11)
   04917 Prolactin signaling pathway
    100928990 (MAPK11)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100928990 (MAPK11)
  Nervous system
   04728 Dopaminergic synapse
    100928990 (MAPK11)
   04723 Retrograde endocannabinoid signaling
    100928990 (MAPK11)
   04722 Neurotrophin signaling pathway
    100928990 (MAPK11)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100928990 (MAPK11)
  Development
   04380 Osteoclast differentiation
    100928990 (MAPK11)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100928990 (MAPK11)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    100928990 (MAPK11)
  Infectious diseases
   05132 Salmonella infection
    100928990 (MAPK11)
   05133 Pertussis
    100928990 (MAPK11)
   05152 Tuberculosis
    100928990 (MAPK11)
   05164 Influenza A
    100928990 (MAPK11)
   05160 Hepatitis C
    100928990 (MAPK11)
   05169 Epstein-Barr virus infection
    100928990 (MAPK11)
   05145 Toxoplasmosis
    100928990 (MAPK11)
   05140 Leishmaniasis
    100928990 (MAPK11)
   05142 Chagas disease (American trypanosomiasis)
    100928990 (MAPK11)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100928990 (MAPK11)
Protein kinases [BR:shr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100928990 (MAPK11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 437 aa AA seqDB search
MRFRQCGMFVSRRVLAVSRVGHQMSRPWSIKCRDCGRGLRRPRVQDHWGQSTLVLKGAVL
LLNISLPDLQGVPGSLSGCRKGQRDRHSQAPGPLSASLHPVLTHPHPRLGLFYSSAYDTR
TRQKVAVKKLSRPFQSLVHARRTYRELRLLKHMKHENVIGLLDVFTPATSIENFNEVYLV
TTLMGADLNNIVRCQKLTDEHIQFLAYQLLRGLKYIHSAGIIHRDLKPSNLAVNEDCELR
ILDFGLARQTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLKGKALFPG
NDYIDQLKRIMEVVGTPSSELLKKISSEHARKYIESLPHMPQKDLRSIFRGANPLAVDLL
EKMLVLDSDRRVSATEALAHPYFAQYHDPEDEPEAEPYDESIENKERTIEEWKELTYEEV
ISFKAPELPMDGLEIEP
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaggtttcgtcagtgtggaatgttcgtgtcacgtcgagtgttggccgtgtcccgagtc
gggcatcagatgtcgcgtccgtggagcattaaatgtcgggattgtgggagaggtcttaga
aggccacgtgtccaagaccactggggccagtctacactggtcctcaaaggtgctgtcctg
ctgttgaacatctccttgcctgacctccagggtgtccccggctccctctctggatgcaga
aaggggcagagggaccggcattctcaggccccaggcccgttgtctgcttccctccacccc
gtcctaacccatccccatccccgactgggcctgttttatagctcggcatatgatacccgc
actcggcaaaaagtagctgtgaagaaactgtcccgtcccttccagtcgttggtccacgcc
aggaggacgtaccgggagctacggctgctgaagcacatgaaacatgaaaatgtcatcggc
ctcctggatgtcttcacgccagccacatctatagaaaacttcaacgaagtgtacctcgtg
accaccctgatgggggctgacctgaacaacattgtcaggtgccagaagctaactgatgaa
catatccagttcctggcataccagctgctgcgggggctgaagtacatccactcggccgga
atcatccacagagacctgaaacccagtaacctggctgtgaatgaggactgcgagctgagg
atcttggacttcgggctggcccgccagacagatgatgagatgacaggctacgttgccacg
cgctggtatcgcgcccctgagatcatgctcaactggatgcattacaaccagacagtggac
atatggtctgtgggctgcatcatggcggaactcttgaaggggaaggcccttttccctgga
aatgactacattgaccagctcaaacggatcatggaggtggttgggacccccagctctgaa
ctgctgaagaagatctcgtctgaacacgctcgaaaatacattgagtccctgccccacatg
ccccagaaggacctgagaagcatcttccgaggagccaacccccttgccgtggacctgctg
gagaagatgctggtcctggacagtgaccggcgggtcagcgccacggaggccctggcacac
ccctactttgcccaataccacgatcccgaggatgagcccgaggcagagccctatgacgag
agcatcgagaacaaagaaaggaccattgaggagtggaaggagctcacctacgaagaggtc
atcagcttcaaggcccccgagctgccgatggacggcctggagattgagccgtga

DBGET integrated database retrieval system