KEGG   Shewanella sp. W3-18-1: Sputw3181_2284Help
Entry
Sputw3181_2284    CDS       T00453                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
shw  Shewanella sp. W3-18-1
Brite
Enzymes [BR:shw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Sputw3181_2284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
2630432..2631457
Genome map
AA seq 341 aa AA seqDB search
MSRELLQTAALNLKKAVPLMLKHKIPTTPVNYALWYTYVGEQNSALNEQLDTVIAQYNTC
PPVSSELLYRQYVADPVELDVREMRQNLDAMVTELSQSLKDTNLDTHEFQSRIESNFEKL
HRIEDEGFSVEQVLDLVRSLVKESDNIRSSTEFFTGQLQKAQTEIDALKKKLEQTEKDVL
YDALTGCLNRRAFDADFSGMLTQAPEGTCVILVDIDHFKVFNDSYGHQMGDQVLRAVAKR
LQESCRDGIKLYRFGGEEFAILVPKSQLRIARQLAEAMRRGLEKLSLKDRRKDERIDNIS
ASFGVAQWQEKQTGLQLIEKADKLLYEAKRLGRNRVMPISN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgagaattattacaaaccgccgcattaaatttaaaaaaagccgttccgctaatg
ctaaaacataaaattcccacgacacctgtgaattatgcactctggtacacctatgtcggg
gagcaaaattcagcattaaatgagcagcttgatactgttatcgcgcaatacaatacctgt
ccgcctgtgagtagtgagttgctctaccgccaatatgtggccgatcccgtcgaattggac
gtacgagaaatgcgccaaaatttagatgccatggtgactgagctttcgcaatcgctcaaa
gacaccaatcttgatacccatgagtttcaatcccgtattgagagcaattttgagaaactc
catcgtattgaagatgaaggttttagtgtcgagcaagtactcgatttagtgcggagttta
gtaaaagaatccgacaatattcgttctagcactgaatttttcaccggacaattacaaaag
gcacaaacggaaatcgatgcccttaagaaaaaactcgaacaaacggaaaaagatgtactt
tacgatgcgctcacagggtgccttaaccgccgcgcatttgatgccgacttcagcggtatg
ctaacccaagctcccgaagggacttgcgtcattttggtcgatatcgatcactttaaagtg
tttaacgactcctatggtcaccaaatgggcgatcaggtattgcgtgccgttgctaagcgc
ttacaagaatcctgccgtgatggaattaaactgtaccgctttggcggtgaagagttcgcc
attctcgtgcctaaaagccaattacgcattgcccgtcaattggctgaagccatgcgccga
gggcttgaaaagctcagcttaaaagacagacgtaaagatgaacgcatcgataatatcagt
gcctcttttggtgtcgcgcaatggcaagaaaaacaaacagggcttcaactgattgaaaag
gcggataagttactctatgaagccaaacgactcggccgtaatcgggtgatgccaataagt
aactag

DBGET integrated database retrieval system