KEGG   Shewanella sp. W3-18-1: Sputw3181_2284Help
Entry
Sputw3181_2284    CDS       T00453                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
shw  Shewanella sp. W3-18-1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2630432..2631457
Genome map
AA seq 341 aa AA seqDB search
MSRELLQTAALNLKKAVPLMLKHKIPTTPVNYALWYTYVGEQNSALNEQLDTVIAQYNTC
PPVSSELLYRQYVADPVELDVREMRQNLDAMVTELSQSLKDTNLDTHEFQSRIESNFEKL
HRIEDEGFSVEQVLDLVRSLVKESDNIRSSTEFFTGQLQKAQTEIDALKKKLEQTEKDVL
YDALTGCLNRRAFDADFSGMLTQAPEGTCVILVDIDHFKVFNDSYGHQMGDQVLRAVAKR
LQESCRDGIKLYRFGGEEFAILVPKSQLRIARQLAEAMRRGLEKLSLKDRRKDERIDNIS
ASFGVAQWQEKQTGLQLIEKADKLLYEAKRLGRNRVMPISN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgagaattattacaaaccgccgcattaaatttaaaaaaagccgttccgctaatg
ctaaaacataaaattcccacgacacctgtgaattatgcactctggtacacctatgtcggg
gagcaaaattcagcattaaatgagcagcttgatactgttatcgcgcaatacaatacctgt
ccgcctgtgagtagtgagttgctctaccgccaatatgtggccgatcccgtcgaattggac
gtacgagaaatgcgccaaaatttagatgccatggtgactgagctttcgcaatcgctcaaa
gacaccaatcttgatacccatgagtttcaatcccgtattgagagcaattttgagaaactc
catcgtattgaagatgaaggttttagtgtcgagcaagtactcgatttagtgcggagttta
gtaaaagaatccgacaatattcgttctagcactgaatttttcaccggacaattacaaaag
gcacaaacggaaatcgatgcccttaagaaaaaactcgaacaaacggaaaaagatgtactt
tacgatgcgctcacagggtgccttaaccgccgcgcatttgatgccgacttcagcggtatg
ctaacccaagctcccgaagggacttgcgtcattttggtcgatatcgatcactttaaagtg
tttaacgactcctatggtcaccaaatgggcgatcaggtattgcgtgccgttgctaagcgc
ttacaagaatcctgccgtgatggaattaaactgtaccgctttggcggtgaagagttcgcc
attctcgtgcctaaaagccaattacgcattgcccgtcaattggctgaagccatgcgccga
gggcttgaaaagctcagcttaaaagacagacgtaaagatgaacgcatcgataatatcagt
gcctcttttggtgtcgcgcaatggcaagaaaaacaaacagggcttcaactgattgaaaag
gcggataagttactctatgaagccaaacgactcggccgtaatcgggtgatgccaataagt
aactag

  All links  
No link information was found.   
DBGET integrated database retrieval system