KEGG   Shewanella sp. W3-18-1: Sputw3181_2856Help
Entry
Sputw3181_2856    CDS       T00453                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
shw  Shewanella sp. W3-18-1
Pathway
shw00500  Starch and sucrose metabolism
shw01100  Metabolic pathways
shw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sputw3181_2856
Enzymes [BR:shw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Sputw3181_2856
Exosome [BR:shw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sputw3181_2856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase AMPK1_CBM NfI_DNAbd_pre-N
Motif
Other DBs
NCBI-ProteinID: ABM25673
JGI: Sputw31812856
UniProt: A1RLX8
Position
complement(3280133..3282370)
Genome map
AA seq 745 aa AA seqDB search
MMTQANAYFYNGADVALLNGQYTDVFSLLGMHTSEDGKSLIVRCFLRNALKVDVISIKDG
RRVAGLEKVNDAGLFAGTMGRRVKPFLYLLRIQYPLSQIEIVDPYQFGPLLNADDLYLFG
EGSAERAYEFLGANWRDVEGIEGVHFCVWAPNAKRVSVVGDFNHWDDTRHVMRQHMANGL
WEIFLPNVAEGAHYKFDLVHPNGERHAKSDPMATQMECAPHNASIVPKKSKHSWKDTLWM
NKRAVTAWHKAPMAIYEVHLGSWRRKGDNGEQYLDYQDLIEQLIPYVKAQSFTHIELMPI
SEYPFDGSWGYQPVGLYAPTHRFGDANGLKAFVDACHQADIGVVLDWVAAHFPKDPHGLV
RFDGTCLYEHEDPRKGTHPDWDTLIYNYGRGEVRSFLLSNACYWLREFHFDGLRIDAVSS
MLYLDYSREPGQWLPNAYGGRENLEAISFLQMLNQRLYQAFPGICMIAEESTAFAGVTKP
TDHHGLGFGFKWNMGWMNDSLSYLSRDPIYRQYHHHQLTFSLMYAYTEQFMLSVSHDEVV
HGKGSLLHKIPGDDWQKFATLRAYYGFMWGHPGKKLLFMGSEFAQRDEWDHNHSLDWHLL
AFEPHQGVQRWLKDLNQLYQGMSALSVLDYQPAGFRWLDCDNGSASIFTFVRYGLAGDAP
LVFVINMTPSVHHGFRIGLPQAGDFCEYLNSDSYLYGGSNQGNAGLVVAQNQSWQGMESS
ALITVPPLSCLVLGPVANQVEAKRR
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgatgactcaagccaatgcttacttctataacggtgccgatgtggcgctgctcaacggt
caatatacggacgtattttcactcttaggcatgcacacttctgaagatggaaaatcgtta
attgttaggtgttttttacgcaatgcgctcaaggttgatgtgattagcattaaagatggt
cgtagggtagcgggtcttgagaaggtcaatgatgcgggcttgtttgcaggtactatgggg
cggcgagttaagccatttctgtacttgttgcgaatacaatatccgcttagccaaatagaa
attgtcgatccctatcagtttggtcctttactcaatgccgatgatttatatctgtttggt
gaagggagtgcagagcgagcatacgaatttttaggagcgaactggcgcgatgttgaaggt
attgaaggagtacatttttgtgtatgggcgcctaatgctaaacgggtttctgtggtcggt
gattttaaccactgggatgatactcggcatgtgatgcgccaacatatggccaatggtttg
tgggagatttttctgcccaacgtggcggaaggtgcgcactacaaatttgatttggtccac
ccaaatggagaacgccacgcaaaatcggatccaatggcgactcaaatggagtgtgcgccg
cataatgcgtctattgttcctaaaaaatccaaacacagttggaaagatacattatggatg
aacaagcgagcagtaacggcgtggcataaagcccccatggcgatttatgaagtccactta
ggttcatggcgacgtaagggcgataatggtgagcaatatcttgattatcaagatctaatt
gaacaacttattccctatgtcaaagcccaaagtttcacccatattgaattaatgcccatc
agtgaatatcccttcgatggctcatggggatatcagccagtaggtctatatgcccctacc
catagatttggtgatgctaacggccttaaggcatttgtggatgcctgccatcaggcggat
atcggtgtggttctcgattgggttgcggcacatttccctaaggatccccacggcctagtg
cgttttgatggtacttgtttgtatgaacatgaagatccgcgcaagggcacgcatcctgac
tgggacacgttaatttacaactatgggcgtggcgaagtgcgtagctttttactgagcaat
gcatgctattggctacgtgagtttcattttgatggtttgaggatcgatgcggtatcgtcg
atgttgtaccttgattatagccgtgagccgggtcaatggctaccgaatgcctatggtggt
cgagaaaacctcgaagccatcagttttctgcaaatgctgaatcaacgcttgtatcaagcc
tttcccggtatttgcatgatagccgaagagtccaccgcctttgcgggcgtcacaaaaccg
acagatcatcatggtttgggctttggctttaaatggaatatggggtggatgaatgacagc
ttaagttacttaagccgtgatcccatttatcgtcaataccatcatcatcaactgaccttc
agtttaatgtatgcctataccgagcaatttatgttgtcggtgagccatgatgaggtggtc
catggcaagggctcactattgcataaaattcccggtgacgattggcaaaaatttgctact
ttgcgcgcttattacggttttatgtgggggcatcccggtaagaagttgctgttcatgggc
agtgaatttgctcagcgggatgagtgggatcataaccacagcttggattggcatttatta
gcgtttgaaccacaccaaggggtgcaacgctggcttaaggatctgaatcagttataccaa
ggcatgtctgcgttatcagtgcttgactaccaacccgcaggctttcgttggctcgactgc
gataatggcagtgccagtatttttacctttgtgcgctatggccttgcgggggatgcaccc
ctcgtctttgtcatcaatatgacacccagtgttcaccatggatttcgcatcggtttaccc
caagcgggggatttttgtgagtacctcaatagcgatagctatctttatggtggtagcaac
caaggtaatgctggtcttgtggttgcccaaaaccaatcatggcaggggatggagtcgagt
gcacttattacggtaccaccccttagctgtttagtccttggcccggtagccaatcaggtt
gaggctaaaagaagatga

DBGET integrated database retrieval system