KEGG   Ruegeria pomeroyi: SPO0343Help
Entry
SPO0343           CDS       T00215                                 

Gene name
sucB
Definition
(RefSeq) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sil  Ruegeria pomeroyi
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPO0343 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPO0343 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    SPO0343 (sucB)
Enzymes [BR:sil01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SPO0343 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
complement(353635..355143)
Genome map
AA seq 502 aa AA seqDB search
MTIEVRVPTLGESVTEATVATWFKKPGDAVAVDEMLCELETDKVTVEVPAPAAGVMGDIV
AKEGETVGVNALLATITAGEGAAAAPAAPAAAAPAASSGGSVDVMVPTLGESVTEATVST
WFKKVGDSVAQDEMLCELETDKVSVEVPAPASGVLTEIVAAEGATVNASAKLAVISGSAS
GASPAPAAPAAAVTPAVATGKDIANAPSAEKAMAEAGITPAQVTGTGRDGRIMKEDVTAA
VAAAAAAPAPAAAAPAPAAAPRAPALAEDAAREERVRMTRLRQTIARRLKDAQNTAAILT
TYNEVDMTEVMALRNTYKDAFEKKHGVRMGFMSFFTKACCHALKEVPEVNAEIDGQDIVY
KNYVHMGVAAGTPQGLVVPVIRDADQMSFAEIEKAIAEKGKRARDGKLSMAEMQGGTFTI
SNGGVYGSLMSSPILNPPQSGILGMHKIQDRPMVINGEIKIRPMMYLALSYDHRIVDGKG
AVTFLVRVKEALEDPRRLLMDL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgaagttcgtgtccccacgcttggcgaatccgtgaccgaggccaccgtggcc
acctggttcaagaaacccggcgacgccgtggccgtcgacgagatgctctgtgagctggaa
accgacaaggtgaccgtcgaggtccccgcccctgccgccggtgtgatgggtgatattgtc
gccaaggaaggcgaaacggttggcgtcaacgcgctgctggccaccattaccgccggtgaa
ggggccgctgcggcccccgccgcacctgccgcagccgcacccgccgccagctcgggcggt
tcggtcgatgtcatggtgccgaccttgggtgaatcggtgaccgaggccaccgtctcgacc
tggttcaagaaggtcggcgacagtgtcgcgcaggacgagatgctgtgcgagctggagacc
gacaaggtctcggtcgaagtgcccgcacccgcgtcgggcgtattgaccgaaatcgtcgcc
gccgaaggcgccaccgtgaacgcatctgccaagctggcggtgatctcgggcagcgcctcg
ggcgccagccctgctccggccgcccccgccgccgcggtcacccccgcggtcgccacgggc
aaggacatcgccaacgcgccctcggcggaaaaggcgatggccgaggccgggatcaccccc
gcgcaggtcaccggaaccgggcgcgatggtcgcatcatgaaagaggatgtcactgccgcc
gtggccgccgcagcagccgcgccggcccctgccgctgccgctccggcccctgccgccgcc
ccccgcgcgcccgcccttgcggaggatgccgcgcgcgaagagcgcgtccgcatgacccgc
ctgcgccagaccatcgcccgccgcctgaaggatgcccagaacaccgccgcgatcctgacc
acctataacgaggtcgacatgaccgaggtgatggcgctgcgcaacacctacaaggacgcg
ttcgagaagaagcacggcgtgcgcatgggcttcatgtccttcttcaccaaggcctgctgc
cacgcgctgaaggaggtgcccgaggtcaacgccgagatcgacggccaggacatcgtctac
aagaactacgtgcatatgggcgtcgccgcgggtacgccgcagggcctggtggtgccggtg
atccgcgacgccgaccagatgtcctttgccgagatcgaaaaggcgatcgccgaaaagggc
aagcgcgcccgtgacggcaagctgtccatggcggaaatgcagggcggcaccttcacgatc
tcgaacggcggcgtctatggctcgctcatgtcctctccgatcctgaaccccccgcagtcg
ggcatcctcggcatgcacaagatccaggaccgcccgatggtcatcaacggcgagatcaag
atccgcccgatgatgtacctggcgctgtcctacgatcaccgcatcgtcgacggcaagggc
gcggtgaccttcctcgtgcgcgtgaaagaggcgctggaagatccccgccgcctgctgatg
gatctgtaa

DBGET integrated database retrieval system