KEGG   Ruegeria pomeroyi: SPO0343Help
Entry
SPO0343           CDS       T00215                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sil  Ruegeria pomeroyi
Pathway
sil00020  Citrate cycle (TCA cycle)
sil00310  Lysine degradation
sil01100  Metabolic pathways
sil01110  Biosynthesis of secondary metabolites
sil01120  Microbial metabolism in diverse environments
sil01130  Biosynthesis of antibiotics
sil01200  Carbon metabolism
Module
sil_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sil_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPO0343 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    SPO0343 (sucB)
Enzymes [BR:sil01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SPO0343 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H HlyD_D23 RnfC_N HrpJ
Motif
Other DBs
NCBI-ProteinID: AAV93661
UniProt: Q5LXC8
Position
complement(353635..355143)
Genome map
AA seq 502 aa AA seqDB search
MTIEVRVPTLGESVTEATVATWFKKPGDAVAVDEMLCELETDKVTVEVPAPAAGVMGDIV
AKEGETVGVNALLATITAGEGAAAAPAAPAAAAPAASSGGSVDVMVPTLGESVTEATVST
WFKKVGDSVAQDEMLCELETDKVSVEVPAPASGVLTEIVAAEGATVNASAKLAVISGSAS
GASPAPAAPAAAVTPAVATGKDIANAPSAEKAMAEAGITPAQVTGTGRDGRIMKEDVTAA
VAAAAAAPAPAAAAPAPAAAPRAPALAEDAAREERVRMTRLRQTIARRLKDAQNTAAILT
TYNEVDMTEVMALRNTYKDAFEKKHGVRMGFMSFFTKACCHALKEVPEVNAEIDGQDIVY
KNYVHMGVAAGTPQGLVVPVIRDADQMSFAEIEKAIAEKGKRARDGKLSMAEMQGGTFTI
SNGGVYGSLMSSPILNPPQSGILGMHKIQDRPMVINGEIKIRPMMYLALSYDHRIVDGKG
AVTFLVRVKEALEDPRRLLMDL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgaagttcgtgtccccacgcttggcgaatccgtgaccgaggccaccgtggcc
acctggttcaagaaacccggcgacgccgtggccgtcgacgagatgctctgtgagctggaa
accgacaaggtgaccgtcgaggtccccgcccctgccgccggtgtgatgggtgatattgtc
gccaaggaaggcgaaacggttggcgtcaacgcgctgctggccaccattaccgccggtgaa
ggggccgctgcggcccccgccgcacctgccgcagccgcacccgccgccagctcgggcggt
tcggtcgatgtcatggtgccgaccttgggtgaatcggtgaccgaggccaccgtctcgacc
tggttcaagaaggtcggcgacagtgtcgcgcaggacgagatgctgtgcgagctggagacc
gacaaggtctcggtcgaagtgcccgcacccgcgtcgggcgtattgaccgaaatcgtcgcc
gccgaaggcgccaccgtgaacgcatctgccaagctggcggtgatctcgggcagcgcctcg
ggcgccagccctgctccggccgcccccgccgccgcggtcacccccgcggtcgccacgggc
aaggacatcgccaacgcgccctcggcggaaaaggcgatggccgaggccgggatcaccccc
gcgcaggtcaccggaaccgggcgcgatggtcgcatcatgaaagaggatgtcactgccgcc
gtggccgccgcagcagccgcgccggcccctgccgctgccgctccggcccctgccgccgcc
ccccgcgcgcccgcccttgcggaggatgccgcgcgcgaagagcgcgtccgcatgacccgc
ctgcgccagaccatcgcccgccgcctgaaggatgcccagaacaccgccgcgatcctgacc
acctataacgaggtcgacatgaccgaggtgatggcgctgcgcaacacctacaaggacgcg
ttcgagaagaagcacggcgtgcgcatgggcttcatgtccttcttcaccaaggcctgctgc
cacgcgctgaaggaggtgcccgaggtcaacgccgagatcgacggccaggacatcgtctac
aagaactacgtgcatatgggcgtcgccgcgggtacgccgcagggcctggtggtgccggtg
atccgcgacgccgaccagatgtcctttgccgagatcgaaaaggcgatcgccgaaaagggc
aagcgcgcccgtgacggcaagctgtccatggcggaaatgcagggcggcaccttcacgatc
tcgaacggcggcgtctatggctcgctcatgtcctctccgatcctgaaccccccgcagtcg
ggcatcctcggcatgcacaagatccaggaccgcccgatggtcatcaacggcgagatcaag
atccgcccgatgatgtacctggcgctgtcctacgatcaccgcatcgtcgacggcaagggc
gcggtgaccttcctcgtgcgcgtgaaagaggcgctggaagatccccgccgcctgctgatg
gatctgtaa

DBGET integrated database retrieval system