KEGG   Setaria italica (foxtail millet): 101760963Help
Entry
101760963         CDS       T02818                                 

Definition
4-alpha-glucanotransferase DPE2-like
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sita  Setaria italica (foxtail millet)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101760963
Enzymes [BR:sita01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     101760963
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 949 aa AA seqDB search
MASSGPTSGKKSLNKVTLLFKLPYYTQWGQSLLIAGSEPALGSWNVKQGLSLSPVHQDNE
LFWCGRVSVAAGFTSEYKYYLVDDNKNVLRWEAGEKRKLVLPEGVQDGDVIEIRDWWQDA
SDALFLRSAFKNVIFNDTEGVKKELQSVSLNKSLDSEDIVVQFVISCPRLVSGSTVVVTG
SNPQLGRWQAQDGLKLSYVGDSIWKANCVLRKSEFPVKYKYCQISQAGNPSLELGPNREV
DIDLSSPKQSRYVVLSDGALRDAPWRGAGVAVPVFSIRSDEDLGVGEFLDLKLLVDWAVN
SGFHLVQLLPINDTSVHGMWWDSYPYSSLSVFALHPLYLRVQALSDSIPADVKEEIQQAK
KHLDKKDVDYEATLSTKMSIAKKIFNLEKDKVLNSSSFKQFLSENEEWLKPYAAFCFLRD
FFETSDHSQWGRFSEFSKEKLEKLISEGTLHHDVIRFHYYVQYHLYMQLSEAAAYARKKK
VILKGDLPIGVDRNSVDTWVYPTLFRMNTATGAPPDYFDKNGQNWGFPTYNWEEMSKDNY
GWWRARLTQMAKYFTAYRIDHILGFFRIWELPDHAATGLVGKFRPSIPLSQEELLSEGLW
DFDRMSRPYIRQEFLEEKFGSFWTVIAANFLTEYQKQCYEFKEDCNTEKKIIAKIKTSPE
KSLWLEKEDSIRRGLFDFIQNIVLIRDPEDPTKFYPRFNLEDTSSFRDLDEHSKNVLRRL
YYDYYFARQENLWRQNALKTLPVLLNSSDMLACGEDLGLIPACVHPVMQELGLIGLRIQR
MPSEPNLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEERRSRFYKTVVGSDEEPPSRC
TPEVVHFIVQQHFDAPSMWAIFPLQDLLALKDKYTTRPAPEETINDPTNPKHYWRFRVHV
TLESLLDDKDIQATIKDLVTSSGRSFPGKVGGADESGEKLSKVQLNGKA
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atggcgagctcggggccaacgtctggaaagaaatctctaaataaggtgactttgctgttc
aaattaccatattacacacaatgggggcagagccttctgattgctggctcggaaccggca
ctgggatcgtggaatgtcaagcaaggactgtctctgagtccagttcatcaggataatgag
ctattctggtgtggaagagtgtctgttgctgctggcttcacctctgagtacaaatactat
ctagtggatgacaacaagaatgtcttgagatgggaggctggggagaaaaggaaactagtc
ctgccagagggcgttcaggatggagatgtaattgaaatccgtgactggtggcaggatgct
tctgatgctcttttccttagaagcgcattcaagaatgtcattttcaatgatactgaaggt
gttaaaaaagaattgcagtcggtgtccctcaacaaaagtttggattctgaagatatcgtt
gtccagttcgtaattagctgtcctcgacttgtatctggctctactgtcgtcgtcactgga
agtaatcctcaattaggaagatggcaagctcaagatggtctcaagctgagctatgttgga
gattccatatggaaagcaaactgtgttttgaggaagtctgagttccctgtaaaatacaaa
tattgtcaaatcagtcaagcaggaaacccttcattggagctaggtccaaacagggaggtt
gatattgatttatcatcgcccaagcaatccagatatgtcgtgttatcagatggtgccctc
agggatgcaccatggaggggtgcaggtgttgccgtacctgtgttttcaatcagatcagat
gaggaccttggtgttggagaatttctagatcttaaactccttgttgactgggcagtcaat
tcaggcttccatcttgtccagctccttccgatcaatgatacttcagtccatgggatgtgg
tgggattcgtatccatacagctcgctctctgtgtttgcgttgcaccccttgtacctaaga
gtacaagcactttcagattcaattccagcggatgttaaggaagaaattcagcaggcaaag
aagcatttggacaaaaaggacgttgactatgaggcaacgctgtctacaaaaatgtcgatt
gctaagaaaatattcaatttagaaaaggacaaagtgctaaactccagttctttcaagcag
ttcttatctgaaaacgaggaatggttgaaaccatatgcggcattttgctttttgcgggac
ttttttgagacatctgatcacagccaatggggtcggttttctgagttttccaaggagaag
cttgagaagcttatttctgaaggtactctgcaccacgacgttatacgttttcattactat
gttcagtaccatctatatatgcaattatcagaggcagctgcatatgcaagaaagaaaaag
gttatcctgaaaggtgatttacctatcggcgttgataggaatagtgtggatacttgggta
tacccgactttgttccgcatgaatactgctaccggagcacctcctgattattttgacaag
aatggacaaaattggggtttccctacatataactgggaggagatgtcaaaggataattat
gggtggtggcgagctcgtctgacacagatggcaaagtacttcacagcatacaggatagac
cacatattgggtttctttaggatatgggagcttccagatcatgctgcaacaggtttagtt
gggaaatttagaccttcgattcctcttagtcaggaggagcttctaagtgaaggcctatgg
gattttgatcgaatgagccgaccatacattcgacaggaatttctggaggagaagtttgga
tccttttggacagtcattgcagccaactttctaactgagtatcagaagcagtgttatgag
tttaaagaagattgcaacacagagaaaaagattattgcgaagattaaaacaagtcctgaa
aagtcactatggttagagaaagaagacagtatccgccgtggtctttttgattttatacag
aatattgtccttatcagagatccagaggaccccacaaaattttatccccgtttcaacctg
gaagatacttcaagttttagggacctagatgaacacagcaaaaatgtcctcagaagactg
tactatgactattattttgctcgccaagaaaatctctggcgtcaaaatgcactgaagact
ctgcctgtcctgttgaattcttcggatatgttggcgtgtggagaagaccttggtcttatc
cctgcttgtgttcaccctgttatgcaagaacttgggttgattggattgcgtatccaaaga
atgcccagtgaaccaaacttggaatttggtattccttctcagtacagctatatgacggtt
tgtgctccctcatgtcatgattgctctactttacgtgcttggtgggaagaagatgaagaa
agaagaagtcgtttctacaaaactgtagttggcagcgatgaagaacccccatctcgctgc
accccagaagtagtgcattttattgttcagcagcattttgatgctccatcaatgtgggca
atctttccacttcaggaccttctcgcactgaaagacaagtacaccacaagaccagcacca
gaggaaacaatcaatgacccaactaacccaaagcactactggagattccgtgtccatgtg
acgttggagtctctgttggatgacaaagacatccaagcaaccatcaaggaccttgtcaca
agtagcgggaggtccttccctggaaaggtgggaggtgccgacgaaagcggagagaagcta
tctaaggtgcagttgaacggtaaagcttag

DBGET integrated database retrieval system