KEGG   Setaria italica (foxtail millet): 101784839Help
Entry
101784839         CDS       T02818                                 

Definition
(RefSeq) alanine aminotransferase 2-like
  KO
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
sita  Setaria italica (foxtail millet)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101784839
   01210 2-Oxocarboxylic acid metabolism
    101784839
   01230 Biosynthesis of amino acids
    101784839
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101784839
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101784839
   00220 Arginine biosynthesis
    101784839
Enzymes [BR:sita01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     101784839
Amino acid related enzymes [BR:sita01007]
 Aminotransferase (transaminase)
  Class I
   101784839
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 484 aa AA seqDB search
MAPRALTVDSLNPKVLALADHLGGDAIARRAQCIQKEIETKPGSHPFDEITYCNLSNPQS
MGQQPNKFFREVLALCDYPRLLEQSETNSLFSSDAIARSRKILDLFPWRATGGYSHCQGT
EGLRDVIAAGITCRDGFPCNAEDIFLTDGAAPPVHMMMHILIRDEKDGILCPIPSHYLYT
SSMVLQGATLVPYYLDESRGWGVRMSDLKKQLDGARSKGVNVRGLVVINPGNPTGHVLVE
ENQREIVEFCRKEDLVLLADEVYQENIYTADKKFKSFKKIARSMGFSEGDISLVSFHSVS
NGYYGECGRRGGYMEVTGFNSEVKKQVYKVASLSSCSNISGQILMSLVMNPPMVEDESYT
SYQAERNGILSTFSRCAESMACALNCLEGVTCCKAEGAMFVFPSVHLPKRAIAAAEERNT
EPDVFYALRLLENTGIVVAPGSVFGQVHGTWHFRCTILPKEEKIPLFISRFTAFHEGFME
EFRN
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggctcctcgcgccctcaccgttgactccctgaacccaaaggtgctggcgctcgcggat
cacctcggcggcgacgccattgcccgccgcgcgcagtgcatccagaaggagatagaaaca
aaacccgggtcacaccctttcgacgagataacctattgcaacctcagcaatcctcagtcc
atggggcagcagccaaacaagtttttccgagaggttcttgcgttgtgtgattatccccgt
cttctagaacagagtgaaactaattccttattcagctctgatgcaatagcaaggtcacgg
aagattcttgacctctttccttggagagcaacaggagggtatagtcactgtcagggtact
gaaggattgcgcgatgtaatagctgctggaataacatgtcgagatggtttcccttgcaat
gcagaagacattttcctgacagatggagcagctccaccggttcacatgatgatgcacata
ctgatacgggatgaaaaagatggtatcctctgcccaattccatcacattatttgtacaca
agttctatggttctccagggtgcgactcttgtaccatattaccttgacgaatctagaggt
tggggagtgaggatgtcagatttgaagaagcagctggatggtgcccgatcaaagggtgta
aatgtgaggggacttgtggtgataaatccaggaaaccctactggacatgttcttgtggag
gaaaatcagcgtgaaattgtggaattctgtaggaaggaagaccttgttcttctagcagat
gaggtttatcaagaaaacatctacacagctgataagaaatttaaatctttcaagaagata
gcacggtccatggggttcagcgaaggagacatatctttagtgtcatttcattcggtttct
aatgggtattatggtgaatgtgggagaaggggaggttatatggaagtcactggctttaat
tctgaagtaaagaaacaagtgtacaaagttgcatccctaagttcatgctccaatatctcc
ggtcagatcctcatgagcctagtcatgaacccaccaatggttgaggatgagtcatacacc
tcttatcaggcagaaagaaatggaatattatcaactttttctcgatgtgctgagtccatg
gcgtgtgcattgaactgcctggaaggagtgacttgctgcaaagctgaaggagcaatgttt
gtgttcccttcagtgcacctgccaaaaagggcaattgcagctgctgaggaacggaacaca
gaaccagatgtattctatgccctccgtcttcttgaaaacactgggattgttgttgcgccg
ggttctgtttttggacaagtacatggtacatggcatttcagatgcacaatcctgccaaaa
gaagagaagataccactgttcatctcccgctttacagcatttcatgaagggttcatggaa
gaatttcgcaactaa

DBGET integrated database retrieval system