KEGG   Solibacillus silvestris: SSIL_0095Help
Entry
SSIL_0095         CDS       T02162                                 

Definition
(RefSeq) asparagine synthase
  KO
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
siv  Solibacillus silvestris
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SSIL_0095
Enzymes [BR:siv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     SSIL_0095
Peptidases [BR:siv01002]
 Cysteine Peptidases
  Family C44
   SSIL_0095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(115599..117425)
Genome map
AA seq 608 aa AA seqDB search
MCGISGWIDFSTHLVNEESMIKKMTRTLLHRGPDSEGYFISKHALLGHKRLAIIDLVTGS
QPMTRGELTIVYNGEVYNANELREQLKSLGHSFHTSSDTEVILMAYVEWKERCMEYLNGI
FAFAVWNEQEHSLFLCRDRLGVKPLFYYELPDGLLFSSEIKGILAHPAVKTEVDAEGLAA
LFSLGPSRIVGHAIFKGIKEVKPAYAMIVRKDFRKSWQYWDIESKQHEHSEAETIENVRE
LVTNAIIRQLISDVPLSTMLSGGLDSSIITAVAARQLAKEQKTLSTYSVAFEENDQHFMQ
NSFQMTQDEYWIGKMQQAFQTKHRQVTLTQQELVEALEQAMRLKDMPSMADIDSSFYLFC
KEMKKEHTVALSGECADEVFGGYPWFYEGKKGTLFPWLRSTKEREQLFKADWQKRLQLPQ
FMQSTYEEAVKGMPAFLGSKEEQERQQLFYLNNQFFMQTLLERNDRMTMGASMEVRVPFA
DHTIIEYVWNIPWEMKNSGGMEKGILRKAFQDILPKEVVERKKNPYPKTYHPKYTELVHQ
RLQQILRQKHSVLHELFEKEQLEQLLATNGQSFQIPWFGQLMAGPQLIAYFIQLHEWVEQ
YRINIITT
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatatcaggttggatcgatttctcgactcatttagtaaatgaagaatcgatg
ataaaaaaaatgacgaggacgcttttacaccgaggtccggatagtgaagggtactttata
agcaaacatgctttattaggccataaacggcttgcaattatcgatttagtgacgggaagc
cagccgatgacacgcggtgagttgaccattgtgtacaatggcgaagtttacaatgcaaat
gagcttcgcgaacagcttaaaagtctaggccattcctttcatacatcatccgatacagaa
gtcattttaatggcgtatgttgaatggaaagaacgctgtatggagtacttaaatggaata
tttgcttttgctgtatggaatgagcaggagcactcgttgtttctatgtcgtgaccggcta
ggggtaaagcctctattttactatgagcttccggatgggctattgttcagctctgaaata
aaagggatcctggcacatcctgctgtaaagacggaagttgatgcagaagggcttgccgca
ttattcagtcttggtccttcccgtattgtagggcatgccatatttaaagggattaaggaa
gttaaacccgcatatgcaatgatagtgcggaaggatttcaggaaaagctggcagtattgg
gatatagaaagtaaacaacatgagcactcagaggcagaaacgattgagaatgtccgggaa
ctcgtaacaaatgcgattatccgtcaattaataagtgatgtgccgctcagtacaatgctt
tcaggcgggcttgattcaagtatcattacggcggttgctgcccggcaattagcgaaagaa
cagaaaacattatcaacgtattccgtagcatttgaagaaaatgaccaacactttatgcaa
aattcatttcaaatgactcaggatgaatactggatcggcaaaatgcaacaggcatttcag
acaaaacaccggcaagtgacattgactcaacaagaattagtagaagctctggaacaggcg
atgcgtttaaaagatatgccgagtatggcggatattgacagctcgttttatttattctgc
aaagagatgaaaaaagaacatacggtagcgttatccggtgaatgtgcggacgaagtattt
ggtggttacccatggttttatgaaggaaaaaagggaacactcttcccgtggctacgctcc
actaaggaacgcgaacagttatttaaagcagattggcaaaagcgtctgcaattgccgcag
tttatgcaaagtacttatgaagaggcagttaagggaatgcctgcatttttaggaagtaaa
gaagagcaggaacgtcagcagctgttttatttaaataaccagttttttatgcagacgtta
ttggagagaaatgaccggatgacaatgggcgcaagtatggaagtccgggtaccgtttgca
gatcatacgataattgagtatgtatggaatattccttgggaaatgaaaaatagcggcggc
atggaaaaagggattttacgaaaggcatttcaggatattttaccgaaggaagttgtggaa
cgtaagaaaaatccgtatccaaaaacgtaccacccaaaatatacagaactcgttcatcag
cgactgcagcaaattttaaggcagaaacactcagttctccatgaattgtttgaaaaagag
cagttagagcaattattagctacaaatggccaatcgtttcaaattccttggtttggccag
ttaatggcggggcctcagctcatcgcctactttatacaattacatgaatgggtcgagcaa
taccgcatcaatattattacaacataa

DBGET integrated database retrieval system