KEGG   Sphingobium japonicum: SJA_C1-20750Help
Entry
SJA_C1-20750      CDS       T01201                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sjp  Sphingobium japonicum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sjp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:complement(2068866..2069474)
Genome map
AA seq 202 aa AA seqDB search
MEYDPDAETAGESIKIPVPADVAEAIRTLIRWSGDDPEREGLVETPERVARAWKEYCRGY
DDDPAYHLSRIFHEVGGYDDIVLLKDIPFQSHCEHHMAPIVGVAHIAYLPGQYVVGISKL
ARVLHAFAHRLQVQERLTSEVANCIWEHLRPQGVAVVVEATHGCMTGRGVRTPNVVMKTS
RMLGVFRDDEKSREEVLKLIAS
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggaatatgatcccgatgccgaaacagcgggcgagtcgatcaagattcctgttccggcg
gacgtggccgaagcgatccggacgctgatccgctggtcgggcgacgatccggaacgggaa
gggctggtcgaaacgcccgaacgcgtggcgcgggcgtggaaggaatattgccgcggctat
gacgacgatccggcctatcatctttcgcgcatctttcacgaagtcggcggctatgacgac
atcgtgctgctgaaggacattccgttccagtcgcattgcgaacatcatatggcgcccatc
gtgggcgtggcgcatatcgcctatctgcccggtcaatatgtcgtcggcatatcgaagctg
gcccgcgtgctgcatgcctttgcccatcggctccaggtgcaggaacggctgacttcggag
gtcgccaattgcatctgggaacatctgaggccccagggcgtcgccgtcgtggtggaggcg
acccatggctgcatgaccgggcgcggcgtgcgcacgcccaatgtcgtcatgaagaccagc
cgcatgctcggcgtcttccgcgacgatgaaaagagccgcgaagaagtgctgaagctgata
gcatcgtga

DBGET integrated database retrieval system