KEGG   Sanguibacter keddieii: Sked_29410Help
Entry
Sked_29410        CDS       T01214                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
ske  Sanguibacter keddieii
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:ske01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ske00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ske00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3277396..3278166
Genome map
AA seq 256 aa AA seqDB search
MAPSGTPPLLTLSVDCGGGGIKAAVLDAAGTAHAPAVRVPTPYPLPPELLVETVAGLARD
LPAADRVSLGMPGMIRHGVVIHTPHYITRTGPRSRVDPALRERWAGFDARAALESRLGVP
TLVLNDAEIHGAGVVAGTGLELVLTLGTGLGSAHFDGGRVAPHLELSHAPVRRGTTYDAY
IGEIERHRLGDGLWSRRVARVVEGLRPVFLWDRLYIGGGNSRRITQAVLDRLGDEVVVVP
NSAALVGGARAWDLFA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggctccctccggcactcccccgctcctcacgctctcggtcgactgcggcgggggtggc
atcaaggctgcggtcctcgacgccgcaggcacggcgcacgcgccggcggtccgggtcccg
acgccctacccgctgccgcccgagctgctggtcgagacggtcgcgggcctcgcacgggac
ctcccggcggccgaccgggtcagcctcgggatgccggggatgatccggcacggcgtggtg
atccacacgccgcactacatcacacgcaccggaccgcgttcccgggtggaccccgccctg
cgcgagcgctgggcagggttcgacgcccgcgccgcgctcgagtcccggctcggtgtcccc
acgctcgtcctcaacgacgcggagatccacggggccggcgtcgtcgccggcacggggctc
gagctcgtgctcaccctcggcaccggcctcgggtcggcgcacttcgacggcggtcgggtc
gcaccgcacctcgagctgtcccacgccccggtccgccgcggcaccacctacgacgcgtac
atcggcgagatcgagcgccaccggctcggcgacgggctctggtcgcgacgcgtggctcgc
gtcgtggaaggcctgcgcccggtgttcctctgggaccgcctctacatcggcggcggcaac
tcccgccggatcacccaggccgtgctcgacaggctcggcgacgaggtggtcgtggtcccg
aactctgccgcgctggtcggcggggcccgggcctgggacctgttcgcgtga

DBGET integrated database retrieval system