KEGG   Spirosoma linguale: Slin_3436Help
Entry
Slin_3436         CDS       T01156                                 

Definition
(GenBank) oxidoreductase domain-containing protein
Organism
sli  Spirosoma linguale
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFO_IDH_MocA GFO_IDH_MocA_C
Motif
Other DBs
NCBI-GeneID: 8727189
NCBI-ProteinID: ADB39444
UniProt: D2QPD6
Position
complement(4163001..4164137)
Genome map
AA seq 378 aa AA seqDB search
MGMVGGGLDAFIGAVHRRAAGFDGEIELVCGCFSSSPDKSKATGHALYLPEDRVYSSFQE
MIEREKALPEGERMDFLSIVTPNHMHFPPAKMALENGFHVMCDKPMTLNLAEAKELAAIV
EKSGLVFGLTHNYTGYPMVKEARDMVRNGKLGKIRKVVVEYPQGWLSKDEEHNDYKQAIW
RTDPARSGAAGCMGDIGTHAENLAEYVTGLQISELCADLTAFVPGRQLDDDGNVLLRFDN
GAKGVLHASQVANGEENSLKIYVWGELGGLEWHQMEPNTLKYKTQEGQRIIRPNVGTLSA
SASAHWRLPAGHPEGFFEAFANLYRNFAYAVKAHMEGREADPLYDFPKASDGVRGLAFID
TVIASSQDDSTKWTKFVQ
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgggtatggttggcggaggcctcgatgccttcattggtgccgtacatcgccgggctgcc
ggttttgatggcgaaatcgaattagtttgtggctgctttagttcatcgcctgataaatca
aaagcaaccggccacgccctgtatttgcccgaagatcgggtttattcttcgtttcaggag
atgattgaacgggaaaaggcattacccgaaggcgaacggatggacttcttgtctattgta
acgcctaatcacatgcactttccccccgccaaaatggcgctcgaaaatgggttccatgtg
atgtgcgacaagcccatgacactgaatctggcggaagccaaagagctggcggccattgtt
gaaaaatcgggcctggtgtttggtctgacgcacaactacaccggctatccgatggtaaaa
gaggcccgcgatatggttcgcaacggcaagctgggcaaaatccgtaaagttgttgtggaa
tacccacaaggctggctctccaaagacgaagagcacaacgactacaagcaggccatctgg
cgtaccgacccggcccggtcgggagccgccggttgcatgggcgacatcggcactcacgcc
gaaaacttagccgagtatgtcacagggttacaaattagtgaactctgcgccgatttgacc
gcctttgttcccggtcgtcaactagacgacgatggcaacgtgctcttgcgattcgataac
ggagctaaaggcgttctgcacgctagccaggtggctaacggcgaagaaaactcgctcaaa
atttacgtttggggtgagctgggcggcctggaatggcaccagatggaacccaataccctg
aaatacaaaacacaggaagggcagcggattatccgccccaatgtgggtaccctttctgcc
tcggcctcggcgcactggcggttaccggcgggtcaccccgaagggttcttcgaagcgttt
gccaacctgtatcgcaacttcgcctatgccgtgaaagcgcatatggaagggcgcgaagct
gatcctctttacgatttccccaaagcatcggacggtgttcgcggattagcctttatcgac
acggtgatcgcatcaagtcaggatgattccacaaagtggactaagtttgtgcagtaa

DBGET integrated database retrieval system