KEGG   Spirosoma linguale: Slin_6427Help
Entry
Slin_6427         CDS       T01156                                 

Definition
esterase/lipase-like protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
sli  Spirosoma linguale
Brite
Enzymes [BR:sli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Slin_6427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7787779..7788711
Genome map
AA seq 310 aa AA seqDB search
MKTVICLLLLAVMGIACSSEPAITTEMLDGGTLFDPSIYKPENYLVSKAIPNPTPDQAKK
PVIIACHGYSATTFEWDEFRAWANGRTDLYLSQVLLGGHGRSYDDFKKSTWHDWQAAIME
EYDQLAKAGYTNISLLGSSTSGALLLQLVSSGYFANRLTPRTILLVDPIVIPSDKSLSLV
GLVGPMLGYFETQQSVSEDKVFFHFRPQETLQQLQNVLTIVRKDLEKGITLPTGCSMKVY
KSKKDSSADPVSAVLIYQGTKTSDGSPVAVELIDSELHVYTRLNLRDQVTAKDRQNQTAT
FTDIVRRVLR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagtcatttgtcttctgctattggctgtcatgggcatcgcctgttcatcggaa
ccggctattacaaccgaaatgctcgatggtggtacgctgttcgacccttcgatctataaa
cccgaaaactatctcgtctcgaaagctattccgaaccccacgcccgatcaggcaaaaaag
ccagttattatcgcctgccacggctattcggcaaccacattcgaatgggacgaattccgg
gcctgggccaacggccgaaccgacctttatctgtcgcaggtgcttctgggcgggcacgga
cgtagttacgatgatttcaaaaagtcgacctggcacgactggcaggcggctattatggag
gaatacgaccagctggcaaaggcgggttacacaaacattagtctgttgggttcatctacc
agcggggcactgctgctgcaactggtgtcgtcgggttatttcgctaatcggctgacccct
cgtactatactgctggttgatcctattgttatcccctccgacaaatcgctttcgctggtt
ggtttggttggacctatgctgggttacttcgaaacgcagcagtcggttagtgaggataaa
gtattttttcacttccgcccccaggaaacccttcaacaattacagaatgtgctgactatc
gttcggaaagacctggaaaaaggcattaccctcccaaccggctgtagtatgaaggtgtat
aagtcgaaaaaagactcgtcggccgacccggtcagtgctgttctgatctatcagggcacc
aaaacctccgatggaagccccgttgccgttgagttgatcgactcggaactgcatgtatat
acgcgcctgaatttacgcgaccaggtaacggccaaagaccgccaaaaccagacggcaacc
tttaccgatattgtgagacgggtactgcggtaa

DBGET integrated database retrieval system