KEGG   Shewanella loihica: Shew_3132Help
Entry
Shew_3132         CDS       T00489                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
slo  Shewanella loihica
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:slo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Shew_3132
Enzymes [BR:slo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Shew_3132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3724413..3724901
Genome map
AA seq 162 aa AA seqDB search
MNTVYVALGANLASPKAQLDQACQALKALASDGQLSVSPYYQSAPMGDVPQPDYLNAVAR
FTTTIAPLALLDALQAIENEQGRVREVRWGARTLDLDLLLYGDWQLDIPRLQVPHYGMKT
RSFVLLPLLDLAPDLILPCGTKLTSLITEELKRQVQQLGPDH
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgtctatgtcgcactgggggccaatctcgcgtcccctaaagcccaactggat
caggcctgtcaggcactgaaggccttggcaagcgacggacaactaagcgtctccccctat
taccaaagcgcccccatgggtgatgtgccgcagcccgactacctcaatgccgtggctcgc
tttaccaccaccatcgccccactggcgctgcttgatgccctacaggcgatcgagaacgaa
cagggtcgggtgcgtgaggtacgctggggcgccagaaccttagatctggacctgctcctc
tatggcgactggcaactggatatcccgcgtcttcaggtgccgcactacggcatgaagacc
cgcagcttcgtgttgctgcccctattggatctggccccagatctcattctcccctgcggc
accaagctgacttcactgatcaccgaggaacttaagagacaagttcaacaactcggcccg
gatcattga

DBGET integrated database retrieval system