KEGG   Sinorhizobium meliloti AK83: Sinme_1248Help
Entry
Sinme_1248        CDS       T01521                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00010  Glycolysis / Gluconeogenesis
smk00020  Citrate cycle (TCA cycle)
smk00620  Pyruvate metabolism
smk01100  Metabolic pathways
smk01110  Biosynthesis of secondary metabolites
smk01120  Microbial metabolism in diverse environments
smk01130  Biosynthesis of antibiotics
smk01200  Carbon metabolism
Module
smk_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sinme_1248
   00020 Citrate cycle (TCA cycle)
    Sinme_1248
   00620 Pyruvate metabolism
    Sinme_1248
Enzymes [BR:smk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Sinme_1248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Peptidase_M23 DUF2118 QRPTase_N GCV_H ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: AEG52996
JGI: Sinme_1248
Position
1:1261072..1262415
Genome map
AA seq 447 aa AA seqDB search
MPINITMPALSPTMEEGNLAKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKIV
VPAGTEGVKVNALIAVLAAEGEDVATAAKGGNGAAGAAPAPKPKETAETAPAAAPAPAAA
PAPQAAAPASPAPADGEGKRIFSSPLARRLAKEAGIDLSAIAGSGPHGRVVKKDVETAVS
GGAAKPAAAPAAAPAPATLAKGMSEDAVLKLFEPGSYELVPHDGMRKTIAKRLVESKQTI
PHFYVSVDCELDALMALRAQLNAAAPEKDGKPVYKLSVNDMVIKALALALRDVPDANVSW
TDQNMVKHKHADVGVAVSIPGGLITPIVRQAELKSLSAISNEMKDLGKRAKERKLKPEEY
QGGTTAVSNMGMMGVKDFAAVVNPPHATILAVGAGEDRVVVRNKEMVIANVMTVTLSTDH
RCVDGALGAELLAAFKRYIENPMGMLV
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcaacatcaccatgccggccctctctccgaccatggaagaaggcaatctggcc
aagtggctggtcaaggaaggcgacaaggtcaagtccggcgatgtgatcgccgagatcgag
accgacaaggcgacgatggaagtggaagccgtcgatgagggcacggtcgccaagatcgtc
gttcccgccggcaccgaaggcgtcaaggtcaatgcgctgatcgcggttctcgccgccgag
ggcgaagacgtcgcgactgccgccaagggcggcaacggtgcagcgggagcagccccggca
ccgaagccgaaggaaacggccgaaacggcaccggccgcggctccggcacccgccgcagcg
ccggcaccgcaagctgctgctccggcttctcctgcgcccgccgatggcgaaggcaagcgc
atcttttcgtcgccgctggcacgccgcctcgcgaaggaggcaggcatcgacctttcggcg
atcgccggttccggaccgcatggccgcgtcgtcaagaaggacgtcgagacagccgtttcc
ggtggcgccgccaagcccgccgccgcgccggcagcagctccggccccggcgacgctcgct
aagggcatgtcggaggacgccgtcctcaagctcttcgagccgggctcctacgaactcgtg
ccgcatgacggcatgcgcaagacgatcgccaagcgcctcgtcgaatcgaagcagacgatc
ccgcatttctatgtttcggtcgattgcgagctcgacgcgcttatggcgctgcgcgcccag
ctgaatgccgcagcacctgaaaaggatggtaagccggtctacaagctttccgtgaacgac
atggtgatcaaggcgcttgctctggcgctgcgcgacgttccggatgcgaatgtgtcctgg
accgatcagaacatggtcaagcacaagcacgcggacgtcggcgtggccgtctccattccc
ggcggcctgatcacgcccatcgtccgccaggcggagttgaagagcctctcggcgatctcc
aacgagatgaaggatctcggcaagcgcgcgaaggagcgcaagctgaagccggaagaatat
cagggcggcaccacggccgtctccaatatgggcatgatgggcgtcaaggacttcgccgcc
gtcgtcaatccgccgcacgcgacgatcctcgcggtcggcgccggcgaggaccgtgtcgtc
gtcaggaacaaggaaatggtcatcgccaatgtgatgaccgtcacgctttcgaccgaccat
cgctgcgtcgatggcgcgctcggcgccgaactgctcgccgccttcaagcgctacatcgaa
aacccgatgggtatgctcgtctga

DBGET integrated database retrieval system