KEGG   Sinorhizobium meliloti AK83: Sinme_1248Help
Entry
Sinme_1248        CDS       T01521                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:smk01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:smk00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:smk00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:smk00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1261072..1262415
Genome map
AA seq 447 aa AA seqDB search
MPINITMPALSPTMEEGNLAKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKIV
VPAGTEGVKVNALIAVLAAEGEDVATAAKGGNGAAGAAPAPKPKETAETAPAAAPAPAAA
PAPQAAAPASPAPADGEGKRIFSSPLARRLAKEAGIDLSAIAGSGPHGRVVKKDVETAVS
GGAAKPAAAPAAAPAPATLAKGMSEDAVLKLFEPGSYELVPHDGMRKTIAKRLVESKQTI
PHFYVSVDCELDALMALRAQLNAAAPEKDGKPVYKLSVNDMVIKALALALRDVPDANVSW
TDQNMVKHKHADVGVAVSIPGGLITPIVRQAELKSLSAISNEMKDLGKRAKERKLKPEEY
QGGTTAVSNMGMMGVKDFAAVVNPPHATILAVGAGEDRVVVRNKEMVIANVMTVTLSTDH
RCVDGALGAELLAAFKRYIENPMGMLV
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcaacatcaccatgccggccctctctccgaccatggaagaaggcaatctggcc
aagtggctggtcaaggaaggcgacaaggtcaagtccggcgatgtgatcgccgagatcgag
accgacaaggcgacgatggaagtggaagccgtcgatgagggcacggtcgccaagatcgtc
gttcccgccggcaccgaaggcgtcaaggtcaatgcgctgatcgcggttctcgccgccgag
ggcgaagacgtcgcgactgccgccaagggcggcaacggtgcagcgggagcagccccggca
ccgaagccgaaggaaacggccgaaacggcaccggccgcggctccggcacccgccgcagcg
ccggcaccgcaagctgctgctccggcttctcctgcgcccgccgatggcgaaggcaagcgc
atcttttcgtcgccgctggcacgccgcctcgcgaaggaggcaggcatcgacctttcggcg
atcgccggttccggaccgcatggccgcgtcgtcaagaaggacgtcgagacagccgtttcc
ggtggcgccgccaagcccgccgccgcgccggcagcagctccggccccggcgacgctcgct
aagggcatgtcggaggacgccgtcctcaagctcttcgagccgggctcctacgaactcgtg
ccgcatgacggcatgcgcaagacgatcgccaagcgcctcgtcgaatcgaagcagacgatc
ccgcatttctatgtttcggtcgattgcgagctcgacgcgcttatggcgctgcgcgcccag
ctgaatgccgcagcacctgaaaaggatggtaagccggtctacaagctttccgtgaacgac
atggtgatcaaggcgcttgctctggcgctgcgcgacgttccggatgcgaatgtgtcctgg
accgatcagaacatggtcaagcacaagcacgcggacgtcggcgtggccgtctccattccc
ggcggcctgatcacgcccatcgtccgccaggcggagttgaagagcctctcggcgatctcc
aacgagatgaaggatctcggcaagcgcgcgaaggagcgcaagctgaagccggaagaatat
cagggcggcaccacggccgtctccaatatgggcatgatgggcgtcaaggacttcgccgcc
gtcgtcaatccgccgcacgcgacgatcctcgcggtcggcgccggcgaggaccgtgtcgtc
gtcaggaacaaggaaatggtcatcgccaatgtgatgaccgtcacgctttcgaccgaccat
cgctgcgtcgatggcgcgctcggcgccgaactgctcgccgccttcaagcgctacatcgaa
aacccgatgggtatgctcgtctga

DBGET integrated database retrieval system