KEGG   Sinorhizobium meliloti AK83: Sinme_3124Help
Entry
Sinme_3124        CDS       T01521                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00020  Citrate cycle (TCA cycle)
smk00190  Oxidative phosphorylation
smk00650  Butanoate metabolism
smk01100  Metabolic pathways
smk01110  Biosynthesis of secondary metabolites
smk01120  Microbial metabolism in diverse environments
smk01130  Biosynthesis of antibiotics
smk01200  Carbon metabolism
Module
smk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
smk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
smk_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sinme_3124
   00650 Butanoate metabolism
    Sinme_3124
  Energy metabolism
   00190 Oxidative phosphorylation
    Sinme_3124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AEG54831
JGI: Sinme_3124
Position
1:complement(3189562..3189942)
Genome map
AA seq 126 aa AA seqDB search
MNMRTPLGKVRGLGSAKEGTDHFWRQRLTAVASIPLTIFFVVFLAHYAGAPHAELIAALS
NPFVAVTMGLMVVAGLVHMKIGMQVIIEDYVHGEGAKIALLMLNTFFTIAVGGLCLFAVL
KIAFAG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgcgcacacctctcggcaaggtccggggtctcggttcggcaaaggaaggcacg
gatcacttctggcggcagcgcctcacggccgtcgccagcattcctctcacgatcttcttc
gtcgtctttctcgcccattatgcgggcgcaccgcatgcggaactgatcgcggccctttcg
aacccgttcgtggcggtgaccatgggtctgatggtcgtcgccggcctcgttcacatgaag
atcggcatgcaggtcatcatcgaggactacgtccatggggagggcgccaagatagcgctt
ctcatgctcaacacattcttcacgatcgcggtcggcgggctctgtcttttcgccgtcctg
aagatcgcatttgcagggtaa

DBGET integrated database retrieval system