KEGG   Selaginella moellendorffii: SELMODRAFT_118934Help
Entry
SELMODRAFT_118934 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K03245  translation initiation factor 3 subunit J
Organism
smo  Selaginella moellendorffii
Pathway
smo03013  RNA transport
Brite
KEGG Orthology (KO) [BR:smo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SELMODRAFT_118934
Ribosome biogenesis [BR:smo03009]
 Eukaryotic Type
  Pre-40S particles
   Other pre-40S particles
    SELMODRAFT_118934
Translation factors [BR:smo03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    SELMODRAFT_118934
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF3_subunit
Motif
Other DBs
NCBI-GeneID: 9644193
NCBI-ProteinID: XP_002983818
JGI: 118934
UniProt: D8SKC7
Position
Unknown
AA seq 228 aa AA seqDB search
DAEDFVPPPPIVSREQPKSQWDDEDKEEEAQVKESWEDEEEKPAPAPKPPKAEKAEKAEK
AEKTDKKGKKSVPAAPQEQKPEEQAPSDPLAEKLKQQRLVEEADYQVTTELFGKESRGRP
FEGFLPKSEADFIEYADLVARELKNYETSYHYMTMLKTLLKTATASMKAADVKEVASAVT
VIANEKLKAEKDSAGKKKGAKKKQLHVDKADEDNYSTAYDDVDEFDFM
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
gacgccgaagatttcgttccgccgccgcctattgtctccagggagcagccgaaatcccag
tgggacgacgaagacaaggaggaggaagctcaagtgaaggaatcatgggaggatgaggag
gaaaagccggcaccagctccaaagcctcccaaggccgagaaagccgagaaagccgagaaa
gctgagaaaaccgacaagaaaggaaagaaatcggtgcccgccgctccacaagagcaaaaa
ccagaagaacaagcgccatctgatcctttggccgagaagcttaaacaacaaagacttgtt
gaagaggctgattatcaagtgacgacagaactctttggcaaggaaagccggggccggcct
ttcgaaggcttcctcccaaaatcggaagcggactttatagagtacgcggatctcgttgct
cgcgagctaaagaattatgagacgagttaccattacatgacaatgctcaagacgctgctg
aagaccgcgacggcgtcaatgaaggcggccgacgtgaaggaagttgcgtcggctgtgaca
gtcatcgctaacgagaagttgaaagcggagaaggactcggccgggaagaagaaaggagcg
aagaaaaagcagctccatgttgacaaagccgacgaggacaattactcgacggcgtatgac
gacgtcgacgagttcgatttcatgtga

DBGET integrated database retrieval system