KEGG   Selaginella moellendorffii: SELMODRAFT_235298Help
Entry
SELMODRAFT_235298 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
smo  Selaginella moellendorffii
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:smo00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 317 aa AA seqDB search
MAAIQEPLVTRDAAGLEKIILKEPLGASAEVYLYGGQVVSWKNDRGEELLFLSSKTSFKP
PKPIRGGIPICFPQFANVGALEKHGFARNRLWSIETDAPPILSSTNASGSNSSRGSTVDL
ILKPAEDDLKMWTHNFELRMRLTLKRGGDLAQTIRVRNTDTKPFTFTFALHTYFSVSDIS
EVRIEGLETLDFLDNLQDRERFTEQGDSITFDGEVDRVYVSTPTKIAIVDHEKKRTIVVK
KEGLPDAVVWNPWDKKAKAMADFGDDEYLHMVCVEPAVIETPITLKPGEEWKGRQEISVV
PSSYCSGQLDPGQVVRG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgattcaggagccgctggtaaccagggatgctgctggtctggaaaagatcatc
ctcaaggagcctttgggagcctcggcggaggtttatctctacgggggacaggttgtttcg
tggaagaatgatcgtggcgaggagctcttgtttctcagcagcaagacgtctttcaagcct
cccaagccaattcgaggtggcataccaatttgcttcccacagttcgcgaatgttggagcg
ctcgagaagcatggatttgcgaggaacaggctgtggtccatcgagactgacgctcctccc
atcctgtcaagcactaacgcaagtggaagcaatagcagccgagggagcactgtcgatctc
atcctcaagcctgcggaagacgacctcaagatgtggacacacaattttgagctgcggatg
cgtcttactctcaagcgaggcggcgatcttgcgcaaaccattcgcgtgaggaacactgat
accaagcctttcacctttacgttcgctctgcacacgtacttctcggtgtcagatatcagt
gaggttcgcattgaaggcctggagacactcgactttctggacaacttacaagacagggag
cgcttcaccgagcagggagactcgatcactttcgatggagaggtggatcgcgtgtacgtc
agcacaccgacgaagatcgccattgttgatcacgaaaaaaagcggacgatagtggtgaaa
aaggaaggcctcccagacgcagtcgtgtggaatccatgggacaagaaagccaaagccatg
gcagactttggagacgacgagtatttacacatggtgtgcgtggagccagcagtgatcgag
acgccaatcactttgaagccgggcgaggaatggaaaggccgccaggagatttcagtggtt
ccttccagctactgcagtggtcagcttgatccgggccaggtcgtgcgcggctag

DBGET integrated database retrieval system