KEGG   Selaginella moellendorffii: SELMODRAFT_421246Help
Entry
SELMODRAFT_421246 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
smo  Selaginella moellendorffii
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:smo00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SELMODRAFT_421246
   03420 Nucleotide excision repair
    SELMODRAFT_421246
   03430 Mismatch repair
    SELMODRAFT_421246
   03440 Homologous recombination
    SELMODRAFT_421246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 279 aa AA seqDB search
MYGDNAAMDFGGGGFMPSQPSGFATGGGDPSVKKSGAPSSGLFPLTVKQMSRAIQSSTDD
NLIVDGQSMSNVTMVGMLLGKEERATDISFMLDDGTGRVEVKRWIESPDAPEALQLHSIQ
HGQYVRIHGHLRTFQNKRTVVAFAVKPITDFNEITFHFLDCIFAHTYNTKSQGAARPDGP
ASPPTFNHTNYSNPVSNPYATPAAPANSNGMSECQRRVQAVFEEPSVKESEQGLHVDEIA
RRITGFSKKQVRDAVEFLVNEGYVYSTVDDEHFKSTNTY
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtatggggacaatgcggctatggattttgggggcggggggttcatgccctcgcagccc
agcggcttcgctactggaggcggcgatccatccgtgaagaaatctggggctccaagcagc
ggtctctttccgcttactgtgaagcagatgagccgggcgattcaatcgtctactgatgat
aatcttattgtggacggccagtctatgagcaatgtcacgatggtggggatgttgctcggg
aaagaggaaagggcgacggatatttccttcatgcttgacgatggaactggcagagtcgaa
gtgaaaagatggatcgagtcaccggatgctcccgaggctttgcagctacacagcattcag
cacggacagtatgtacgaattcacggacaccttcggacgttccagaacaagagaacagtt
gtcgcttttgcagtgaagcctatcacagacttcaacgagatcacgttccacttcctggac
tgcatctttgcacatacctacaacacgaaatcacagggggcggcaaggcctgacggtccc
gcgtctcctcccactttcaatcacacaaactattccaatcccgtatccaatccgtatgct
actccagcggctcctgcgaattccaatgggatgagtgaatgccaacgccgggtacaggcg
gtttttgaggagccatctgttaaggaaagtgagcagggccttcacgttgatgagattgcg
agacgcattactggtttctccaagaagcaagtcagagatgcggtggagtttctggtgaac
gaaggttacgtttattccactgtcgacgacgagcatttcaagtccaccaacacttactaa

DBGET integrated database retrieval system