KEGG   Selaginella moellendorffii: SELMODRAFT_443756Help
Entry
SELMODRAFT_443756 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
smo  Selaginella moellendorffii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:smo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SELMODRAFT_443756
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1797 aa AA seqDB search
MVSYRRLQSTVEVALAGSPSPQQRTELFHMLHLCRPDFESFLLYPEPKAADRTEVLSKEV
KLPDAPPTVLDDQDVQIALKLSDDYHLNEIDCVSLLVAAHQEWNLLGREPLEGLRLSAGL
WFTERRALINSLQLILRAVVLDEELDPDLVVDLRQYIESLIDAGLRKRLVTLIKELGRED
PSGLGGPGVEPYVMDARGALVLRHDVALRERLSICQCLVFSCLIVRINSQEAKDIYGLVK
DCSGDAFSSQSVVKLQIAYTVMFTLAISLISDALGGGHEMGSVLSPDAVFRREFHNQVME
VGLESTTKGFTDVIRLVWGVFLMSNVDTSGISINESQSDITNARACLDHACEQNVFKFLV
EKILKAAAFENDDPDLVFMYNAYLHKLFIIFLSNPIGREKIKDLKNVAMFSDPYPTEEPM
EDDLITRRQAMQTQADPFISLLELISEVYQREPALVSDNEVLWNFIRFISEDHSSYLTLV
AFLKMLVGLACSEEGARQVYQMLQNKTFRTEGDAKALDAYLQVLKKVLEAGSEVERSLWF
PDIEPLFKLLPFENVPPYLKGSLRNAISAFVPLSPVIRDRVWSLLDAYDLPLSAATTLGG
ANVQQVYDMTFELNEVEARQEEYPSTISYLNLLNVLMANDPDKSHKGQKFAGIFKFVRDQ
VFGPYAQRAYADPTYKWQMVVASLRHFQMMLTLYDVSEGDLQNSLEGSEQSFGGAKLYLP
PIEIMKDLMGGKSIFRSLMSIVMLGADFVLEERISKNYGPSLEEAVQLCLELLVIAFQKD
IFYADHWRPIYQTIDAILSHDSRQIITLIQYIHYESLSTIQHLSIKIMDVFRCDCFTPSN
CAKRVLLDSSRLPHIVSLIVDANAAANLVEDYAACLEARSHELQTSDCVKEDSGSLILRI
NLLNGQSFNQNAYTVLQLVYELCVDEFTSGPMLDLMRTEKYDFFSCHLDSACEPLPKRET
NHSLRISSLQQRAWLFKLLALDLHVSDMDVLSHRRSCRRLVGKLFMDESVDPLPVTNAVP
ALLTNYGLQKMKVLELLDILQFPLAEPPTEIPQCIEDFKEDLKVEEILNNPALVDDGGIY
TLSERGDRIIDLTAFRDKLWQACKRLEMQYNILANERRQVAVRDAVQQLLRWAWKRNKFL
EEQAAQLHMLVGWTQLVEVTFSRRFEFLGNRIQVIYDTLEAVLDASCSSDCSLSMAYVLS
QVVLTSMAKLQDHGIFAPGEEDYNDDAIYGDVLTTVRLPNTACQTILSKLLTGVLRPESS
EALRRRQFASLLSYFHYCQGMVNSELSVSMMRGLLMEGQDGVEDTEFEKLEGDQAELAQM
NFNMLRQEATALLDLVCKDALHGSETAKAIAFYVLEALVAVDRNQVKKSLHVFSLFSNFS
NIQALILPSRDMIRRLYTLEAELALLLRVCFHNKKRGAQALFAMGAIQHLSSCKAIDVQL
TDDARKEHMGIGLPSQHDRQHQIVIPVLRLILCFTTLIDTGRKDRDEVALEVLEFVKLHH
GLFDRILRDDGTKMYLADLEELHLATAILSKVWPFEGSEDFGFKQGLFNLAYIYFAQDNQ
SRSGFIQFSKSQRQNMGVPAEDSKKIELLVTRLRGNLVSYIHTLVSKQGMRLNISGTDSS
EVVMRHYTLGLQRQPSLKLVSSLLEQAALDLESSAEEKMLIVAKLPDINELTRQEVDDIA
KSKQGSEMESMRKRRYLAMVEMCTDASIRDTQIACLVLVVEQALEILYLHVEAIQQAAQG
AEDSMQAQKGELDALGQKLLPTFEKLESIKEDKVGRGVKHIHRLIYSLKSQTRRYFD
NT seq 5394 nt NT seq  +upstreamnt  +downstreamnt
atggtttcttacaggcgcctgcaatccacagtggaggtggcgctggcaggatcgccatcg
ccacagcagcgcacggagctcttccatatgctgcatttgtgccgcccagacttcgaatca
ttcctcctctatccggagcccaaggcagccgatcgaacagaggttttatcgaaagaagtg
aagctgccggacgcgccgcccaccgtgctcgacgatcaggatgttcaaattgctttgaaa
ctcagtgacgactatcatttgaatgagatcgattgcgtgagtcttctcgtcgctgctcat
caagagtggaatctcttaggacgtgagcctctcgagggcctccgactatcagcagggttg
tggttcacggaaagaagagcgctaatcaactccttgcagcttattctgagagccgttgtg
cttgacgaagagcttgatccagacttggtcgttgatcttcgacaatacatcgagagtttg
attgacgctggactacgcaagcgacttgtgacacttatcaaggaacttggtcgcgaagat
ccatctggcttaggcgggccaggggttgagccttacgttatggatgccaggggagctctt
gtgctacgtcatgacgtcgcgcttagagaacggcttagcatatgccagtgtttggtcttt
tcatgccttattgttcggatcaattcgcaagaagcaaaagacatctatggtcttgttaag
gactgttcgggagatgcattttcgtcacaatccgtcgtcaagcttcagatagcgtacaca
gtgatgtttacccttgcaatctcgttaatatcggacgctctcggtggtggtcacgagatg
ggatctgtgctttcgccagatgctgtatttcgccgtgagttccataatcaggttatggag
gtggggcttgagagcacaacgaaaggttttacagatgtcattagactagtatggggggtc
ttccttatgtctaacgttgacacgagcggtatttcaatcaacgaatcacaatctgatata
acaaatgctcgagcatgtcttgatcacgcttgcgagcagaacgtttttaaattcctcgtt
gagaaaattttaaaagctgccgccttcgagaatgatgatccagatcttgtgttcatgtac
aatgcttatttgcacaaacttttcataatatttttgtccaatccaatcggcagagagaag
atcaaagatttgaagaatgtcgccatgttttctgatccgtatccgaccgaggagccaatg
gaggatgatttgataacacgccgtcaagctatgcaaacacaagctgatccttttatatct
ttgctcgagcttatatcagaagtctaccagagagaaccagcacttgtttctgataatgaa
gttctttggaacttcataagattcataagcgaagaccattcaagctaccttacattagtt
gcttttctcaagatgctggttggattggcttgcagtgaggaaggggctagacaagtgtac
cagatgctacagaacaagactttccgtactgagggagatgccaaagctcttgacgcctat
ttgcaagttttgaaaaaggtcttggaggctggtagcgaggtggaaaggtcactctggttc
ccggatattgaaccgctttttaagcttctcccatttgaaaatgttccaccgtatttgaag
ggatctttgcgaaatgcaatctctgcctttgttccgttatctccagttataagagacaga
gtatggagcttgctggatgcttatgatcttcctctgtcagctgccactacattgggagga
gccaatgtgcaacaagtttacgacatgacgtttgaactgaatgaagtggaggcaaggcaa
gaagagtatccctctacaatttcatatttgaacctgctgaatgttctgatggcaaatgac
cccgacaagtctcacaagggccaaaaattcgctggcatattcaagtttgtccgagatcag
gtgttcggtccgtatgctcaaagggcctatgctgatcccacatataaatggcagatggtg
gttgcatcccttaggcacttccaaatgatgctgacgctatatgatgtgtccgagggggat
cttcaaaattccttggaaggatctgagcagagctttggcggagcaaagctgtatcttccg
ccaattgaaataatgaaggatttgatgggcggaaaatctatcttccgaagtctcatgagc
attgttatgcttggagctgattttgtactggaggaacgcattagcaaaaactatggtcca
tctcttgaggaagcggtgcagctttgtttggagcttttagttattgcctttcagaaagat
attttttatgccgaccactggcgaccgatttatcagactatcgatgctatattgtcgcat
gacagccgccaaatcataaccttgatccagtacatccattatgaatcgctatcaactatc
caacatctgtcgatcaagatcatggatgtctttaggtgcgattgttttacaccatcgaat
tgcgctaaaagagttttattggacagttcgcgattgccacacatagtttctttaattgtc
gatgccaatgccgcagcaaatcttgttgaggactatgcagcctgtttagaagcccgcagt
catgaacttcagacttctgactgtgttaaagaagactcgggctctcttattttgcggatc
aacctgttgaacggacaatccttcaaccaaaacgcgtatacagttctacagctggtgtat
gagctctgtgtcgatgaatttacaagtggcccgatgcttgaccttatgcgaacggagaaa
tacgatttcttttcttgccatttggactctgcttgtgagccacttcctaagcgagagaca
aaccattctttacgtattagcagtttgcagcagagagcatggctttttaagctattggca
ctggatttgcatgtcagtgacatggatgttttgtcacatcgtcggagttgtcgtcgcctt
gtggggaagctttttatggacgaaagcgtggatcctctgcctgtgacaaatgccgtgccg
gcgttgcttactaactatggccttcaaaaaatgaaggttctggagctccttgatatcttg
cagtttcctttggcagagcctccaaccgaaattccacagtgcatagaagactttaaagaa
gatttgaaggttgaagagattctgaacaatccagcattggtcgacgatggtggcatctat
acgctttcagaacgtggcgacagaataatcgatctgactgctttcagggacaagctttgg
caggcgtgcaagaggctagaaatgcaatataacattttggcaaatgagcgacgacaagtg
gcagtacgtgacgccgtgcagcagctacttaggtgggcatggaagcgcaacaagtttttg
gaagaacaagctgcacagttacacatgcttgtgggatggacacaactagtagaggtgaca
ttctccagacgatttgagttcttagggaaccgcattcaagtgatctatgacacgctggaa
gcggttttggacgcaagttgttcttcagactgttctttgagcatggcttatgtcttgagc
caggttgtgctgacatcaatggcaaaacttcaagatcatggtatatttgcgcctggtgaa
gaagattacaatgatgacgctatatatggagatgttttgacaacggtccgtttacccaat
accgcgtgccagaccatcctctcgaaactccttaccggtgtattgcgacctgagtcatct
gaagctttaagacgaaggcaatttgcatctttgttaagctattttcattattgccaaggc
atggtaaattcggaactttcggtttccatgatgcggggacttttgatggaggggcaagac
ggcgttgaggacacagaattcgaaaagctagaaggggatcaggccgaacttgctcaaatg
aactttaatatgcttaggcaggaggctactgccctgcttgacttggtttgtaaagatgca
ttacatggaagtgaaacggcaaaggccattgcgttttatgttctagaggcacttgtggcg
gttgatcgtaatcaggtgaagaagtcattacatgttttctcgctgtttagtaacttctcg
aacatacaggctttaattctgccttctcgtgacatgatccgacgtctatatactctggag
gctgaattggcattacttttaagagtgtgttttcacaacaagaaacgaggcgcgcaagca
ttgtttgccatgggtgccatccaacatctgtcatcctgtaaagctattgatgtccagctg
acggacgatgcgagaaaggagcatatgggaattggactcccatcacaacatgacaggcag
catcagattgtcatacccgttctgaggttgattttatgttttacgacgctaattgacaca
ggaagaaaagatcgcgatgaagtagctcttgaagttctagagtttgttaaacttcatcat
ggtttgttcgaccgtatcttgcgagacgatgggacgaaaatgtatctggcagacctggaa
gaactccatttggcgactgcaattttatcgaaggtgtggccattcgagggctctgaggac
tttggcttcaaacaaggcctgttcaatttggcatacatatatttcgcgcaggacaatcaa
tcacgtagtggattcattcagttttctaaaagccaacgtcaaaatatgggggtacctgct
gaggactcaaagaaaatagagcttcttgtgacgcgccttcgtggcaatctggtttcctac
attcacacattagtcagcaagcagggaatgagattaaacatctctggaacagacagttct
gaggtggttatgcgacactacaccttgggacttcaaaggcaacccagcctcaagcttgtc
tcaagtcttttggaacaggcggctttagatctcgaatcttctgcggaagagaaaatgctt
atcgtggctaagcttcctgatattaacgagcttacaaggcaggaagtcgatgacatcgca
aagtctaagcaagggtccgaaatggaaagcatgcgaaagagaaggtacttggcaatggtg
gagatgtgtacagatgccagcatccgcgatactcaaatcgcttgccttgttctcgtcgtg
gagcaagctttggaaatcctctacctccatgtcgaagcgatacaacaagctgcccaagga
gccgaggattcaatgcaggcacagaaaggcgagctggatgctcttgggcagaagctactc
ccaacgtttgagaagctggagtccatcaaagaggacaaggtgggacgaggagtgaagcac
atccacaggctcatttactctctaaagtcccaaactcggcggtacttcgattga

DBGET integrated database retrieval system