KEGG   Sordaria macrospora: SMAC_06526Help
Entry
SMAC_06526        CDS       T01610                                 

Gene name
mek2
Definition
MEK2 protein
Organism
smp  Sordaria macrospora
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 501 aa AA seqDB search
MKRKNVKGLALAPAAPKPPPTAETFYKDKDDDNNAQLEIGIEFNLDLRPEDLELIKELGA
GNGGTVSKVRHIPTNTVMARKVIHVEAKKEMRKRIVRELQIMHGCHSEYIVTFYGAFLNE
HNDVIMCMEYMDVGSLDRISRVFGPVRVDVLGKIAEATLGGLTYLYSKHHIMHRDIKPSN
ILVNSKGHIKLCDFGVSGELVNSVADTFVGTSTYMAPERIQGDKYTVKSDVWSFGLSIME
LAIGKFPFASDQLGDDAENAPAGILDLLQQIVHEPAPKLPKSDAFPQILEDMIQKCLYKE
PERRPTPQELFDRDPFVQAAKRTPVDLREWACSLMDRDNRKSHLQPQLSPTTQELLRSSD
EPTPTSGEIPILGTMVSPRDQHSSVPNRPPPRSRTDSAGRTGGPPIHPGLGARVATTGSQ
PRYPQQAPTPPPSEKRPSMSTGHSYTSSSSSTRSGFALPIRPGPPGQPMPPPPPRRQLTA
EELQRESRRQAAMQQPPTGRF
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcaagaacgtcaaaggtcttgccttggctcccgccgcccccaaaccccctcca
actgccgagaccttttataaggataaagacgacgacaacaatgcccagctagagattggc
atcgagttcaacctggatctcaggcctgaggatctggagctgatcaaggagttgggagct
ggaaatggaggcaccgtcagcaaagtcaggcatatcccgacaaatacagttatggctcgc
aaggtcatccatgttgaggccaagaaggagatgcgcaagcgcatcgtccgcgagcttcag
atcatgcacggctgccattccgagtatattgtcaccttctatggcgccttcctcaacgag
cataacgatgtgattatgtgcatggagtacatggatgttggttcgctcgaccgcatctcc
cgtgttttcggtcccgttcgtgtcgacgttctcggaaagatcgccgaagctacactcggt
ggcctcacgtatctttactccaagcaccacatcatgcacagagacatcaagccctccaac
atcctcgtcaactcgaagggccacatcaagctttgcgattttggtgtttccggagagctg
gtcaactctgtcgccgacacctttgtgggcacatccacctacatggctcctgaaagaatt
cagggtgacaagtacacggtcaagtccgatgtatggagtttcggtttgtcgatcatggag
ttggcaattggcaagttcccgttcgctagtgatcagcttggggatgatgctgaaaatgct
cccgccggtattctcgaccttctccaacaaattgttcacgagccagcaccgaagctaccc
aagagcgacgctttcccacaaattcttgaggacatgatccagaagtgtctttacaaggaa
cctgagaggcgaccgacgccccaagagctctttgatcgcgatcccttcgtacaagcggca
aagagaaccccagtcgacctgagagagtgggcttgcagcctgatggaccgggataaccgc
aagtctcatctccagccccaactctctccgacaacgcaagaacttttaaggtccagcgat
gaacctacacccacttcaggtgagattcccattctggggactatggtgtcacctcgtgac
caacatagcagcgtaccaaaccgacccccgccacgcagccgaacagacagcgctggccgc
acaggtggaccgcctatacatccgggactgggagcgcgagtagctacgactggctctcag
cccaggtacccgcagcaggcgcctactcctcctccgtccgaaaagcgaccatccatgtcg
accggccattcgtatactagttcctcgtcctcgacccgatcgggcttcgccctacccatc
cgaccggggcctccgggccagccgatgccgccgccgcccccgcgaagacagcttacagcg
gaggaactgcagagggaaagtcgccggcaagccgcaatgcagcagcctccaaccggccga
ttttaa

DBGET integrated database retrieval system