KEGG   Sordaria macrospora: SMAC_06526Help
Entry
SMAC_06526        CDS       T01610                                 

Gene name
mek2
Definition
MEK2 protein
Orthology
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
smp  Sordaria macrospora
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:smp00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    SMAC_06526 (mek2)
Enzymes [BR:smp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     SMAC_06526 (mek2)
Protein kinases [BR:smp01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   SMAC_06526 (mek2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 501 aa AA seqDB search
MKRKNVKGLALAPAAPKPPPTAETFYKDKDDDNNAQLEIGIEFNLDLRPEDLELIKELGA
GNGGTVSKVRHIPTNTVMARKVIHVEAKKEMRKRIVRELQIMHGCHSEYIVTFYGAFLNE
HNDVIMCMEYMDVGSLDRISRVFGPVRVDVLGKIAEATLGGLTYLYSKHHIMHRDIKPSN
ILVNSKGHIKLCDFGVSGELVNSVADTFVGTSTYMAPERIQGDKYTVKSDVWSFGLSIME
LAIGKFPFASDQLGDDAENAPAGILDLLQQIVHEPAPKLPKSDAFPQILEDMIQKCLYKE
PERRPTPQELFDRDPFVQAAKRTPVDLREWACSLMDRDNRKSHLQPQLSPTTQELLRSSD
EPTPTSGEIPILGTMVSPRDQHSSVPNRPPPRSRTDSAGRTGGPPIHPGLGARVATTGSQ
PRYPQQAPTPPPSEKRPSMSTGHSYTSSSSSTRSGFALPIRPGPPGQPMPPPPPRRQLTA
EELQRESRRQAAMQQPPTGRF
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcaagaacgtcaaaggtcttgccttggctcccgccgcccccaaaccccctcca
actgccgagaccttttataaggataaagacgacgacaacaatgcccagctagagattggc
atcgagttcaacctggatctcaggcctgaggatctggagctgatcaaggagttgggagct
ggaaatggaggcaccgtcagcaaagtcaggcatatcccgacaaatacagttatggctcgc
aaggtcatccatgttgaggccaagaaggagatgcgcaagcgcatcgtccgcgagcttcag
atcatgcacggctgccattccgagtatattgtcaccttctatggcgccttcctcaacgag
cataacgatgtgattatgtgcatggagtacatggatgttggttcgctcgaccgcatctcc
cgtgttttcggtcccgttcgtgtcgacgttctcggaaagatcgccgaagctacactcggt
ggcctcacgtatctttactccaagcaccacatcatgcacagagacatcaagccctccaac
atcctcgtcaactcgaagggccacatcaagctttgcgattttggtgtttccggagagctg
gtcaactctgtcgccgacacctttgtgggcacatccacctacatggctcctgaaagaatt
cagggtgacaagtacacggtcaagtccgatgtatggagtttcggtttgtcgatcatggag
ttggcaattggcaagttcccgttcgctagtgatcagcttggggatgatgctgaaaatgct
cccgccggtattctcgaccttctccaacaaattgttcacgagccagcaccgaagctaccc
aagagcgacgctttcccacaaattcttgaggacatgatccagaagtgtctttacaaggaa
cctgagaggcgaccgacgccccaagagctctttgatcgcgatcccttcgtacaagcggca
aagagaaccccagtcgacctgagagagtgggcttgcagcctgatggaccgggataaccgc
aagtctcatctccagccccaactctctccgacaacgcaagaacttttaaggtccagcgat
gaacctacacccacttcaggtgagattcccattctggggactatggtgtcacctcgtgac
caacatagcagcgtaccaaaccgacccccgccacgcagccgaacagacagcgctggccgc
acaggtggaccgcctatacatccgggactgggagcgcgagtagctacgactggctctcag
cccaggtacccgcagcaggcgcctactcctcctccgtccgaaaagcgaccatccatgtcg
accggccattcgtatactagttcctcgtcctcgacccgatcgggcttcgccctacccatc
cgaccggggcctccgggccagccgatgccgccgccgcccccgcgaagacagcttacagcg
gaggaactgcagagggaaagtcgccggcaagccgcaatgcagcagcctccaaccggccga
ttttaa

DBGET integrated database retrieval system