KEGG   Streptococcus mutans UA159: SMU_881Help
Entry
SMU_881           CDS       T00100                                 

Gene name
gtfA
Definition
sucrose phosphorylase GtfA
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
smu  Streptococcus mutans UA159
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SMU_881 (gtfA)
Enzymes [BR:smu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     SMU_881 (gtfA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
833680..835125
Genome map
AA seq 481 aa AA seqDB search
MPIINKTMLITYADSLGKNLKELNENIENYFGDAVGGVHLLPFFPSTGDRGFAPIDYHEV
DSAFGDWDDVKCLGEKYYLMFDFMINHISRQSKYYKDYQEKHEASAYKDLFLNWDKFWPK
NRPTQEDVDLIYKRKDRAPKQEIQFADGSVEHLWNTFGEEQIDLDVTKEVTMDFIRSTIE
NLAANGCDLIRLDAFAYAVKKLDTNDFFVEPEIWTLLDKVRDIAAVSGAEILPEIHEHYT
IQFKIADHDYYVYDFALPMVTLYSLYSSKVDRLAKWLKMSPMKQFTTLDTHDGIGVVDVK
DILTDEEITYTSNELYKVGANVNRKYSTAEYNNLDIYQINSTYYSALGDDDQKYFLARLI
QAFAPGIPQVYYVGFLAGKNDLELLESTKEGRNINRHYYSSEEIAKEVKRPVVKALLNLF
TYRNQSAAFDLDGRIEVETPNEATIVIERQNKDGSHIAKAEINLQDMTYRVTENDQTISF
E
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgccaattataaataaaacaatgttgattacttacgcagacagtttgggtaaaaatttg
aaagaattgaatgaaaatattgagaattattttggagatgctgttggcggtgtccatttg
ctgccattctttccttccacaggtgatcgtggctttgcaccgattgattaccatgaagtt
gactctgcttttggcgattgggatgatgtcaaatgcttgggtgaaaaatattacctcatg
tttgatttcatgattaatcatatttcgcgtcagtctaaatattataaagattaccaagaa
aagcatgaagcaagtgcttataaagatctatttttaaattgggataaattttggcctaaa
aatcgcccgacacaagaagatgtggacctgatttataagcgtaaggatcgagcacctaag
caggaaatccaatttgcagatggcagtgttgaacatctctggaacacttttggggaggaa
cagattgatcttgacgtgactaaagaagtgactatggattttattcgctctaccattgaa
aatttagcagccaacggctgtgatctcattcgtttggatgcctttgcttatgctgttaaa
aagctagatacgaatgatttctttgttgaacctgaaatctggactctgctagataaagtt
cgtgatatagctgctgtatcgggtgcggaaatcttgccggaaattcatgaacactatact
attcaatttaaaattgcagaccatgattactatgtttatgattttgccctgcctatggtg
acgctctacagcctatattcgagcaaggttgaccgtcttgccaaatggctgaaaatgagt
ccgatgaaacagttcaccacccttgatacacatgacggtattggtgtggttgatgttaag
gatatcctgactgacgaagaaattacctatacttctaatgagctttataaggtcggtgcc
aatgtcaatcgtaagtattcaactgccgaatataataacttggatatctatcaaattaat
tcaacttactattcagcacttggtgatgatgatcaaaaatactttttggcccgcttgata
caagcttttgctccaggtattccacaggtttattacgttggctttttagctggcaagaat
gatcttgaattactggaaagcactaaagaaggccgcaatatcaaccgtcattattatagt
agtgaagaaattgctaaggaagtgaagcggccagttgtcaaggcacttttaaatctcttt
acttaccgcaatcagtcagcagcttttgatttggatggccgtattgaagtggaaacgcca
aatgaagcgaccattgtcatagaacgtcaaaataaagatggcagtcatatcgcaaaagca
gagattaatctccaagatatgacatacagagtaacagaaaatgatcaaacaataagcttt
gaataa

DBGET integrated database retrieval system