KEGG   Stenotrophomonas maltophilia D457: SMD_0276Help
Entry
SMD_0276          CDS       T02061                                 

Gene name
arcA
Definition
Arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SMD_0276 (arcA)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SMD_0276 (arcA)
Enzymes [BR:smz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SMD_0276 (arcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
327464..328384
Genome map
AA seq 306 aa AA seqDB search
MAHPISVSLIGVPTDVGAGHRGARLGPEALRVAGLPEALEARGVDVRDVSNLDGPRNPWT
APVEGYRHLDEVVAWNHALMEASYAELQAGRMPIMLGGDHCLGIGSITAVARWCREQGKT
LRVLWLDAHSDFNTSDVTPSGNIHGMPVACLCGLGPEALTHLGGSAPAITPAQMHQIGIR
SVDPEEKRLIKTHKVDVYDMRYIDENGMKRAVEAALAGIDENTHLHVSFDVDFLDPSIAP
GVGTTVPGGVNYREAQLVMEMIADTGRMGSLDIVELNPLLDKQNATAELAVDLVESLFGK
STLMRD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcccatcccatctccgtatccctgattggcgttcccaccgacgtcggtgcgggccat
cgcggtgcacggctggggccggaggcgctgcgcgtggcgggcctgccggaggcgctggaa
gcgcgtggtgtggacgtgcgtgacgtgagcaatctggatggcccacgcaacccgtggacc
gcgccggtggaaggctaccgccatctggatgaagtggtggcgtggaaccatgcactgatg
gaagccagctacgccgagctgcaggccggccgcatgcccatcatgctcggcggcgaccac
tgcctggggatcggttcgatcaccgccgtcgcgcgctggtgccgcgagcagggcaagacc
ctgcgcgtgctgtggctggatgcgcactcggatttcaacaccagcgatgtcaccccgtcg
ggcaacatccacggcatgccggtggcctgcctgtgcggcctcggcccggaggcgctgacc
cacctgggcggcagcgcaccggcgatcaccccggcgcagatgcaccagatcggcatccgc
tcggtggacccggaggagaagcgcctgatcaagacccacaaggtggatgtgtacgacatg
cgctacatcgatgagaacggcatgaagcgcgcggtggaggcggcgctggccggcatcgat
gagaacacccacctgcatgtcagcttcgatgtggacttcctcgacccgagcatcgcgccg
ggcgtgggcaccacggtgccgggtggggtgaactaccgcgaggcgcagctggtgatggag
atgatcgccgacaccgggcgcatgggatcgctggacatcgtcgagctcaaccccttgctg
gacaagcagaatgccaccgccgaactggccgtggacctggtcgaaagcctgttcggcaag
tccaccctgatgcgcgactga

DBGET integrated database retrieval system