KEGG   Stenotrophomonas maltophilia D457: SMD_0276Help
Entry
SMD_0276          CDS       T02061                                 

Gene name
arcA
Definition
(GenBank) Arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
smz00220  Arginine biosynthesis
smz00330  Arginine and proline metabolism
smz01100  Metabolic pathways
smz01110  Biosynthesis of secondary metabolites
smz01130  Biosynthesis of antibiotics
smz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smz00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    SMD_0276 (arcA)
   00330 Arginine and proline metabolism
    SMD_0276 (arcA)
Enzymes [BR:smz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SMD_0276 (arcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: CCH10875
Position
327464..328384
Genome map
AA seq 306 aa AA seqDB search
MAHPISVSLIGVPTDVGAGHRGARLGPEALRVAGLPEALEARGVDVRDVSNLDGPRNPWT
APVEGYRHLDEVVAWNHALMEASYAELQAGRMPIMLGGDHCLGIGSITAVARWCREQGKT
LRVLWLDAHSDFNTSDVTPSGNIHGMPVACLCGLGPEALTHLGGSAPAITPAQMHQIGIR
SVDPEEKRLIKTHKVDVYDMRYIDENGMKRAVEAALAGIDENTHLHVSFDVDFLDPSIAP
GVGTTVPGGVNYREAQLVMEMIADTGRMGSLDIVELNPLLDKQNATAELAVDLVESLFGK
STLMRD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcccatcccatctccgtatccctgattggcgttcccaccgacgtcggtgcgggccat
cgcggtgcacggctggggccggaggcgctgcgcgtggcgggcctgccggaggcgctggaa
gcgcgtggtgtggacgtgcgtgacgtgagcaatctggatggcccacgcaacccgtggacc
gcgccggtggaaggctaccgccatctggatgaagtggtggcgtggaaccatgcactgatg
gaagccagctacgccgagctgcaggccggccgcatgcccatcatgctcggcggcgaccac
tgcctggggatcggttcgatcaccgccgtcgcgcgctggtgccgcgagcagggcaagacc
ctgcgcgtgctgtggctggatgcgcactcggatttcaacaccagcgatgtcaccccgtcg
ggcaacatccacggcatgccggtggcctgcctgtgcggcctcggcccggaggcgctgacc
cacctgggcggcagcgcaccggcgatcaccccggcgcagatgcaccagatcggcatccgc
tcggtggacccggaggagaagcgcctgatcaagacccacaaggtggatgtgtacgacatg
cgctacatcgatgagaacggcatgaagcgcgcggtggaggcggcgctggccggcatcgat
gagaacacccacctgcatgtcagcttcgatgtggacttcctcgacccgagcatcgcgccg
ggcgtgggcaccacggtgccgggtggggtgaactaccgcgaggcgcagctggtgatggag
atgatcgccgacaccgggcgcatgggatcgctggacatcgtcgagctcaaccccttgctg
gacaagcagaatgccaccgccgaactggccgtggacctggtcgaaagcctgttcggcaag
tccaccctgatgcgcgactga

DBGET integrated database retrieval system