KEGG   Stackebrandtia nassauensis: Snas_0604Help
Entry
Snas_0604         CDS       T01194                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sna  Stackebrandtia nassauensis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Snas_0604
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Snas_0604
   00640 Propanoate metabolism
    Snas_0604
   00660 C5-Branched dibasic acid metabolism
    Snas_0604
Enzymes [BR:sna01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Snas_0604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
638803..639981
Genome map
AA seq 392 aa AA seqDB search
MDLYEYQGRALFARHGVPVLDGGVAETVEEAVELAGKLDGRVVVKAQVKVGGRGKAGGVK
LADNVDEAREHATNILGMDIKGHTVHKVMLTVTADIDTEFYFSFLLDRANRTFLCIASTE
GGVEIEQVAAETPDKVLKLPINALTGVDATVAGEIADKAGFPADLRPQLVDMFVKLWETF
VSEDATLVEVNPLVRTPEGRALALDAKVTLDENAAFRHLDHAELEDKAAVDPLEQRAKEA
DLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEKHDNVKPANFLDIGGGASAAVMASGLE
VVLSDPAVKSVFVNVFGGITACDEVANGIVGALTMLAERGETVDKPLVVRLDGNNAELGR
SILDGANHPLVTRVDTMDGAADKAAELAAQGA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgtatgaataccaggggcgcgcgctgttcgcccggcacggcgtgccggtgctg
gacgggggcgtagccgagaccgtcgaggaggcggtcgagctcgccggaaagctcgatggg
cgagtggtcgtcaaggcgcaagtcaaggtcggcggccggggcaaggcggggggtgtcaag
ctcgccgacaacgtcgacgaggctcgtgaacacgccaccaacatcctcggcatggacatc
aagggacataccgtccacaaggtcatgttgacggtcaccgccgacatcgacaccgagttc
tacttctcgttcctgctggaccgtgccaaccgcaccttcctgtgtatcgcgtccactgag
ggcggtgtggagatcgagcaggtggccgccgagacgcccgacaaggtgctcaagctgccg
atcaacgccctgaccggcgtcgacgccaccgtcgcgggcgagatcgccgacaaggccgga
ttcccggccgacctcaggccgcagctggtcgacatgttcgtcaagctgtgggagaccttc
gtgtccgaggacgccaccctcgtggaggtcaacccgctggtgcgcacgcccgagggccgg
gcgctggcgctggacgccaaggtgaccctggacgagaacgccgcgttccggcacctcgac
cacgccgagctcgaggacaaggccgccgtcgacccgctggaacagcgcgccaaggaagcc
gacctcaactacgtcaaactggacggtgaggtcggcatcatcggcaacggcgccggactc
gtcatgtccaccctggacgtcgtcgcgtacgcgggcgagaagcacgacaacgtcaagccc
gccaacttcctcgacatcggcggcggcgcctccgccgcggtcatggcctcgggcctggag
gtcgtcctgtccgacccggccgtcaagagcgtcttcgtcaacgtcttcggcggcatcacc
gcctgcgacgaggtcgccaacggcatcgtcggcgcgctgaccatgctggccgaacgcggc
gagacggtggacaagccgctggtcgtgcggctggacggcaacaacgccgaactgggccgt
tcgatcctggacggcgccaaccacccgctcgtgacccgagtggacaccatggacggcgcg
gccgacaaggccgccgagctcgccgcgcagggagcgtga

DBGET integrated database retrieval system