KEGG   Shewanella oneidensis: SO_2073Help
Entry
SO_2073           CDS       T00099                                 

Gene name
hisD
Definition
(RefSeq) histidinol dehydrogenase HisD
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
son  Shewanella oneidensis
Pathway
son00340  Histidine metabolism
son01100  Metabolic pathways
son01110  Biosynthesis of secondary metabolites
son01230  Biosynthesis of amino acids
Module
son_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    SO_2073 (hisD)
Enzymes [BR:son01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SO_2073 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-GeneID: 1169818
NCBI-ProteinID: NP_717676
UniProt: Q8EFB1
Position
complement(2169636..2170952)
Genome map
AA seq 438 aa AA seqDB search
MDMLTWAALSADEQKTALQRSPLIGDSGLEQSVRAIVDAVASRGDAAIKEFNQKFDGARL
ANISSANSDNLRLSEHEIEAASARVSPELKAAIAQAMANIDVFHSAQQFRPIDIETQAGV
RCELRSEPIEKVGLYIPGGSAPLISTVLMLALPATIAGCEQRVLVSPPPINDAIVYAANV
CGITEIYQVGGAQAIAALAFGTETIPSVDKIFGPGNRYVTEAKRLVSQDGRCTVSIDMPA
GPSEVLVIADSDANAQFIAADLLSQAEHGPDSQVILVTDSLPLAQAVNQALKSQLAALPR
QEIAATALKGSRTILVKDMQEAALVSNRYGPEHLIIQTRFPREVLNNIRAAGSVFLGAYT
PESVGDYASGTNHVLPTYGYSRAVSSLSLADFSRRFTVQELSAKGLLGLGQAVMTLASNE
LLDAHKNAVAVRLASLKG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggatatgttaacttgggcagcgttatcagccgatgaacaaaaaaccgcgcttcaacgc
tcacctttaatcggtgatagcggcttagaacaaagtgttcgcgccattgtcgatgccgtt
gccagccgtggcgatgcagcgattaaagagtttaatcaaaagtttgatggtgcaaggctt
gcaaatatcagtagtgccaatagcgacaacttacgtttaagcgagcacgaaatcgaagcg
gccagcgcgcgggtatcgcccgaactgaaagctgcgattgcccaagcgatggccaatatt
gatgtgtttcacagcgcacaacaatttcgccccatcgacattgaaacccaagcgggggtt
cgctgcgagcttcgtagcgaaccgattgaaaaagtgggtttatatattcctggcggtagc
gccccattaatctcaaccgtactgatgttggccctgccagccacaattgctggctgcgaa
caacgggtactcgtgagtccaccaccgatcaatgatgcgattgtttatgccgcaaatgtc
tgcggcattaccgagatctatcaagtgggtggcgcgcaggcgattgccgcactggccttt
ggcactgaaacgattcctagcgtcgataagatttttggcccaggcaatcgttatgtcacc
gaggccaagcgcttagtctcgcaggacggtcgctgtactgtgtctatcgatatgccagca
ggcccttccgaggtattagtgattgccgatagcgatgccaatgcgcagtttattgccgcg
gatttactctcccaagcggagcacggtcctgattcgcaggtcattttagtcactgattct
ttgccattagcacaggcggttaatcaggcactcaaatcgcaactggccgccctgccacgc
caagagattgccgctaccgccttaaaaggcagccgcaccattctggtcaaagatatgcaa
gaagccgcgctcgtttcaaatcgctatgggcctgaacacttaattattcaaacccgtttt
ccgcgggaagtgctaaataatattcgcgctgcaggctcagtgtttttaggcgcctataca
cctgaatcggttggggattacgccagtggcactaaccatgtattgccgacttatggttac
agccgcgcagtatcgagtctctcactggccgacttcagtcgccgctttacggtgcaagaa
ctcagtgccaagggcctgctaggtcttggacaagcggtgatgacccttgccagcaatgag
ttactcgatgcccataaaaatgcagttgcggtgcgcttagccagtcttaaaggctga

DBGET integrated database retrieval system