KEGG   Solanum tuberosum (potato): 102595925Help
Entry
102595925         CDS       T02981                                 

Definition
NADH-cytochrome b5 reductase-like protein-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
sot  Solanum tuberosum (potato)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sot00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    102595925
Enzymes [BR:sot01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     102595925
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 323 aa AA seqDB search
MTALLRKLAKAAPVAFRGDSKSNFADPRFPFGAIAAVAGCVSYYYCHSSANLVYLEQINE
DSGKKVALNPDKWIEFKLQDRAPVSHNSHLFRFSFDPSSKLGLDIASCILTRAPMGENAE
GKPKYAIRPYTPISDPEAKGYFDLLIKVYPEGKMSQHFARLKPGDVLEVKGPIEKLRYSS
NMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQVSLVYANLSPDDILLKKKLDVLADTH
PNLKVFYTVDNSTNDWRGGIGYVSKDMIVKGLPPPGDDTLILVCGPPGMIRHLSGEKPNP
HEQGELTGLLKDVGFTENMVYKF
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgttgttgaggaagctagccaaggctgcacccgtagcatttcgaggcgattcc
aagtcaaattttgctgatcctcgcttcccttttggagctattgcagccgttgctggatgc
gtctcttattattactgccattcttctgcgaatttggtgtacttggagcaaattaatgaa
gattctggtaaaaaagttgctctaaatcctgataaatggattgaatttaagctgcaagat
cgagctccagttagccacaatagtcatctattcaggttttcttttgatccttcttcaaag
ttaggtcttgatattgcatcttgcattcttacgagggcaccaatgggagaaaatgctgaa
ggaaaaccaaaatatgccattcggccttatactcctatatctgatccagaagccaaggga
tactttgatttgttaattaaggtttatccagaagggaaaatgagccagcattttgcaaga
ctaaaaccgggcgatgtacttgaagtaaaagggcccattgagaaattgcgttacagttca
aacatgaagaaacatataggcatgattgcggggggcagtggcatcactcctatgctccag
gtgatagaggccattcttaaaaaccccgatgataatactcaggtctcattggtttatgct
aatttgtcacctgatgacatactgctaaagaagaaacttgatgtacttgcagacacccat
ccgaatctcaaggtattttacactgtagataattcaaccaatgattggagaggcggcata
ggttacgtatcaaaggacatgattgtgaaaggattacctccgcctggtgatgatacactt
attcttgtatgtggccctcctgggatgataagacatttatctggggaaaagccaaaccct
catgagcaaggcgagctaacgggactactcaaggatgtgggctttacagagaacatggtt
tacaaattttaa

DBGET integrated database retrieval system