KEGG   Sphingomonas panacis: AWL63_23850Help
Entry
AWL63_23850       CDS       T04760                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
span  Sphingomonas panacis
Pathway
span00071  Fatty acid degradation
span00072  Synthesis and degradation of ketone bodies
span00280  Valine, leucine and isoleucine degradation
span00310  Lysine degradation
span00362  Benzoate degradation
span00380  Tryptophan metabolism
span00620  Pyruvate metabolism
span00630  Glyoxylate and dicarboxylate metabolism
span00640  Propanoate metabolism
span00650  Butanoate metabolism
span00900  Terpenoid backbone biosynthesis
span01100  Metabolic pathways
span01110  Biosynthesis of secondary metabolites
span01120  Microbial metabolism in diverse environments
span01130  Biosynthesis of antibiotics
span01200  Carbon metabolism
span01212  Fatty acid metabolism
span02020  Two-component system
Brite
KEGG Orthology (KO) [BR:span00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AWL63_23850
   00630 Glyoxylate and dicarboxylate metabolism
    AWL63_23850
   00640 Propanoate metabolism
    AWL63_23850
   00650 Butanoate metabolism
    AWL63_23850
  Lipid metabolism
   00071 Fatty acid degradation
    AWL63_23850
   00072 Synthesis and degradation of ketone bodies
    AWL63_23850
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AWL63_23850
   00310 Lysine degradation
    AWL63_23850
   00380 Tryptophan metabolism
    AWL63_23850
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AWL63_23850
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AWL63_23850
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AWL63_23850
Enzymes [BR:span01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AWL63_23850
Exosome [BR:span04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AWL63_23850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AOH87200
UniProt: A0A1B3ZIE5
Position
unnamed:216345..217523
Genome map
AA seq 392 aa AA seqDB search
MDPIYITSAKRTAIGTFGGSLKDKSPSELAALCVKALLIESGIPIDAVGHSVFGQVLPTS
PRDAYIARIAAVEAGLPHEVPALTVNRLCGSGLQAIVTAAQMLMLGDASVAVAGGAEVMS
AVPYHAPTERWGKRMGDARLVDALERALDDPFGGGAMGVTAENIAERYGVSRDRQDRYAL
ESQRRAAKALAEGYFTDQIVPVEVQRGRSVEAFRVDEHVRGETTIEQLAKLRTLFKQDGS
VTAGNASGINDGAAAILLATESAVTTHALAPLARIVAYGHAGVDPNFMGIGPVPASRIAL
GKAGLSVDDMDVIESNEAFAAQACAVADQLGFPAERVNPNGSGISLGHPVGATGAIILTK
LVHELRRQNGRYGLATMCIGGGQGIALVVERV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaccctatctatattacctcggcaaagcgcactgcgatcggcacattcggtggcagt
ctgaaggataagtcaccgagcgagctggcggcgctgtgcgtcaaggctctcctgatcgag
agcggcatcccgatcgatgctgttggacatagcgtgttcggccaggttctgccgacgtca
ccgcgagacgcctatatcgcgcgcatcgcggcggtcgaggccgggctgccgcacgaagtg
ccggcactgaccgtcaaccgcttatgcggatcgggccttcaagccatcgtgaccgccgcc
cagatgctgatgctcggcgacgcgtcggtcgcggtcgccgggggcgccgaggtcatgagt
gcggtgccgtatcacgcgccgaccgagcgctgggggaagcgcatgggcgatgctcgcctg
gtcgacgccttggagcgtgccctggacgatccgttcggcggtggcgcgatgggggtaacc
gccgagaatatcgccgaacggtacggcgtctcgcgcgatcgtcaggacagatatgcgctc
gaaagccagcgccgcgccgccaaggcgctagcagagggttatttcaccgatcagatcgtg
ccggtcgaggtccagcgcggccgctcggtcgaggccttcagagtcgatgagcatgttcgc
ggcgagaccaccatcgagcaactcgccaaactccggacgcttttcaagcaggatggaagc
gtgacggcgggcaacgcctccggcatcaacgatggcgcagccgcgatattgcttgcgacc
gaaagcgcggtgacaacacacgcacttgccccgctcgcgcgcatcgtcgcttacggtcat
gctggggttgatcccaactttatggggattggtccggtgccggcatcgcgcatcgctctt
ggcaaggccggcttgtcggtcgatgacatggacgtgatcgagtcgaacgaggcattcgca
gcccaggcctgcgccgttgccgaccaactgggtttccccgccgaacgcgtcaatcccaat
ggcagcggaatctcgctcgggcatccggttggtgccaccggcgccatcatcctgacgaag
ctggtacatgaactgcgccggcaaaacggccgctacgggctcgcaaccatgtgcatcggc
ggcggtcagggcatcgcgctggtggtggagcgggtctga

DBGET integrated database retrieval system