KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_1822Help
Entry
SPD_1822          CDS       T00413                                 

Definition
ribosomal large subunit pseudouridine synthase, RluD subfamily protein
Orthology
K06180  
23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
Brite
Enzymes [BR:spd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     SPD_1822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1806543..1807418
Genome map
AA seq 291 aa AA seqDB search
MQFTFTLPASLPQMTVKQLLEEQLLIPRKIRHFLRIKKHILINQEEVRWNEIVNPGDVCQ
LTFDEEDYPQKTIPWGNPDLVQEVYQDQHLIIVNKPEGMKTHGNQPNEIALLNHVSTYVG
QTCYVVHRLDMETSGLVLFAKNPFILPILNRLLEKKEISREYWALVDGNINRKELVFRDK
IGRDRHDRRKRIVDAKNGKYAETHVSRLKQFSNKTSLAHCKLKTGRTHQIRVHLLHHNLP
ILGDPLYNSKSKTSRLMLHAFRLSFTHPLTLERLTFTTLSNTFEKELKKNG
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcacatttacattacccgcctctctacctcaaatgacggtaaagcaattactt
gaggaacaactcctcatccctagaaaaatccgtcattttttgagaatcaagaaacatatt
ttgataaatcaagaagaagtccgctggaacgaaatcgtaaatcctggagatgtttgccag
ttgacttttgacgaggaagattatccccaaaagacgatcccttggggcaacccagactta
gtgcaggaagtttatcaagatcaacacttgattattgtaaacaaaccagaggggatgaaa
acgcatggtaatcaaccaaacgaaattgcccttcttaaccatgtcagtacctatgttggc
caaacctgctatgtcgttcatcgtctggacatggaaaccagtggcttagttctctttgcc
aaaaatccttttatcctgcccattctcaatcgcttattggagaaaaaagagatttctaga
gaatattgggctctagttgatggaaatatcaacagaaaagaacttgttttcagagacaaa
attggacgtgatcgccatgatcgtagaaaaagaatagttgatgcaaaaaatgggaaatat
gctgaaacgcatgtaagcagattaaagcaattctcaaacaagacttccttggctcattgc
aagctaaagacagggcgaacccatcagattcgtgtgcaccttttgcatcataatcttcct
atcctgggagaccctctctataatagtaaatcaaagacaagccggcttatgcttcatgcc
ttccgactttcctttacccacccacttactttagagaggctaactttcactaccctttca
aatacatttgaaaaagaattaaaaaagaatggatga

DBGET integrated database retrieval system