KEGG   Serratia proteamaculans: Spro_0536Help
Entry
Spro_0536         CDS       T00595                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
spe  Serratia proteamaculans
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Spro_0536
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Spro_0536
Enzymes [BR:spe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Spro_0536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
592234..594627
Genome map
AA seq 797 aa AA seqDB search
MHRSLRYTLLASSLLLSLGALAQPAGDLPLMPWPQQVELTQPAGRLVLDHRLSINLQGDD
LGDALPRWRQRIELQTGWTLAPQAAKAAGVVINVNIKDKVAAQPLPGSDESYKLLVMQDG
VTLTANTRFGALRGMETLLQLVQTDGQNTFLPLVSITDVPRFPWRGVLLDSARHFLPLAD
ILRQLDGMAAAKLNVFHWHLTDDQGWRFASEHYPKLQQQASDGQFYTREQMQQVVAYATA
RGIRVVPEIDLPGHASSIAVAYPELMSAPGPYQMERKWGVHKPTLDPTREEVYQFVDAII
GELAAIFPDPYLHIGGDEVDASQWKQSKTIQAFMQQHQLADIHALQAYFNQKLEKILEQH
QRQMVGWDEIYHPSLPRSIVIQSWQGQDSLGASAQDGYQGILSTGFYLDQPQSSAYHYRN
EILPQPLGVATEVQPDEKAQSWQFSMPRLKGSAVEGSFTLIEGKQGWRGFIDFNGKSRRA
LQDIVWRSPQQVSFRVDTWMGETRPVFTLQQDKLSGYTLVGNVRYPTSGGKLTAIPAGKM
PVVPDAKQQSNILGGEAALWAENIRAPILDLKLWPRGFAVAERLWSAQDVTDENNMYRRL
AAVDAWSVVSVGLQQHAETAREFTRLANSVQIAPLQTLAEAVEPGQYYTRQHLKFKAGNY
HQFEPLNRFADALPAESNAVREMGLQVAALVKDRNNSAAAQALRERLQRWQLNTAPVKTV
IAGNRVMQDLAPVAQDVGALAALGLMLLERYQQNKPLSKAEAGQIQQQLDTAAQIRDEVV
IAAVYPLEALLRASAIE
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgcacagatctctgcgttatacgctactggcttcatcgttattgctttccctgggcgcg
ctggcgcagccggccggcgatttgccgctgatgccctggccgcagcaggtggaactgacc
caaccggcgggcaggctggtgctggaccaccgtttgtcgattaacctgcagggtgacgat
ttgggtgatgcgctgccgcgctggcggcaacgtattgagctgcaaaccggttggacgctg
gcaccgcaggcggcaaaagccgcaggcgtggtgattaacgtgaacatcaaagacaaggtg
gcggcgcagccgctgccgggcagcgacgagagctataaactgctggtgatgcaggatggc
gtcaccctgaccgccaatacccgtttcggtgcgctgcgtggcatggaaaccctgctgcaa
ctggtgcagaccgacggccagaacaccttcctgccgctggtgagtatcaccgacgtaccg
cgtttcccgtggcgcggcgtgctgctggattcggcgcgtcatttcctgccgctggcggat
attctgcgccagctcgacggcatggcggcagccaagctcaacgtgtttcactggcacctg
accgacgatcagggttggcgttttgcttctgagcattatcccaagctgcaacagcaggcc
agcgacggccagttttatactcgcgaacagatgcaacaggtggtggcctatgccaccgcg
cgcggcatccgggtggtgccggaaatcgatctgccgggtcatgcttccagcatcgccgtg
gcttacccggagctgatgagcgcgccggggccgtatcagatggagcgcaagtggggtgtc
cataagccaacgctcgatccgacccgtgaagaagtttatcaatttgtagacgctattatt
ggcgaactggcggcgatcttccccgatccttacctgcatattggcggtgacgaggtggat
gccagccaatggaagcaatcgaaaaccattcaggcctttatgcagcaacatcagttggcg
gacatccatgcattgcaggcctacttcaaccagaagctggaaaaaatcctcgaacagcac
caacggcagatggtcggttgggatgagatttatcacccgtcgctaccacgcagcattgtg
atccaatcctggcagggtcaggactcactgggggccagcgcgcaggacggctatcagggc
attctgtccaccggcttctacctcgatcaaccacagagcagcgcctatcactatcgcaac
gagatcctgccgcagccgctgggcgtcgccaccgaggtgcagcccgatgaaaaggcgcag
agctggcagttcagcatgccgcgactgaagggcagcgcggtggagggcagttttaccctg
attgaaggcaaacaaggctggcgtggctttatcgacttcaacggcaaatctcgccgtgca
ttgcaggatatcgtctggcgttctccgcagcaggtgagcttccgcgtcgatacctggatg
ggcgagacgcgtccggtgttcacgctgcagcaggataagctcagtgggtatacgctggtt
ggcaacgtgcgttacccgaccagcggcggcaagctgacggcgatcccggcgggcaagatg
ccggtggtaccggacgcgaagcagcagagcaatattcttggcggcgaggcggcgctgtgg
gcggaaaacatcagggcgccgatcctcgatctcaagctgtggccgcgcgggttcgcggtg
gcggagcgcttgtggtcggcacaggacgtaaccgatgaaaacaacatgtaccggcggctg
gcggcagttgacgcctggtcggtggtgtcggtgggcttgcagcagcatgcagagaccgcc
cgcgaattcacccggctggcgaacagcgtgcagattgcaccgctgcaaaccctggccgag
gcggtcgagccgggccagtactacacccgtcagcatctgaaattcaaggccggtaattat
caccagttcgaaccgctgaatcgctttgccgacgctctgccggcggaaagcaacgcagtg
cgcgagatggggctgcaggtcgcggccctggtgaaagatcgcaataacagtgcggcggca
caggcgctgcgcgaacgtttgcaacgctggcagttgaataccgcgccggtgaaaacggtg
attgccggtaaccgggtgatgcaggatctggctccggtagcgcaggatgtcggcgcgctg
gcggcactggggctgatgctgctggaacgttatcagcagaacaaacccttgagcaaagcc
gaagccgggcaaatacagcaacagctggatacggcggcgcaaatacgtgacgaagtggtg
attgcggcggtttatccgctggaagccctgctgcgtgccagcgcgatcgaataa

DBGET integrated database retrieval system