KEGG   Serratia proteamaculans: Spro_3173Help
Entry
Spro_3173         CDS       T00595                                 

Gene name
lacZ
Definition
beta-D-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
spe  Serratia proteamaculans
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:spe00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:spe00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:spe00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3491438..3494527
Genome map
AA seq 1029 aa AA seqDB search
MSSLPYPSLKDLLARRDWQNPACTHYQRLAAHPPFSSWRNLNAARDDKSSESRQILNGDW
QFSYFDKPQAVPDGWLQQDLTDADTLAVPSNWQLAAYDAPIYTNVRYPIPVNPPQVPEEN
PTGCYSRQFTVDPAWLAEGQTRIIFDGVNSAFYLWCNGHWVGYSQDSRLPAEFDLSPWLQ
AGENRLAVMVLRWCDGSYLEDQDMWRMSGIFRDVSLLHKPATHLSDIRITTPLYDSFRRG
ELVAEVHINQPAQHRVQLQLWRDGQLVGEKTQAFGSEIIDERGAYEDRTTLCLPVEQPAL
WSAETPTLYRATVTLLSPEGKIIEVEAYDVGFRQVEISNGLLKLNGQPLLIRGTNRHEHH
PQHGQVMDEATMRHDILLMKQHNFNAVRCSHYPNHPLWYRLCDRYGLYVVDEANIETHGM
QPMNRLSDDPLWLPAMSERVTRMVQRDRNHPCIIIWSLGNESGHGCNHDALYRWVKTQDP
TRPVQYEGGGANSAATDIICPMYARVDQDQPFPAVPKWSIKKWIGLPDEHRPLILCEYAH
AMGNSFGGFDRYWQAFRQYPRLQGGFVWDWVDQALTRSDENGNPYWAYGGDFGDTPNDRQ
FCLNGLVFPDRTPHPALFEAQRAQQFFQFTFDAETLTLTVNSEYLFRQTDNERLNWRLEL
DGTERASGSFDLNLLPQSSASFPLLERLPMLHQPGELWLNVEVVQPLATDWSEANHRCAW
DQWLVPRTLHFAPPAVAGSAPQLSQNDQTIDITHGHQRWQFTRHDGCLSQWWQHDHSQLL
TPLRDNFIRAPLDNDIGISEVERIDPNAWVERWKLAGMYRLEERCTLLQADQLSDGVRVV
SEHLFEADGQTLLRSRKQWLFDSEGAVSISVDVDIAASLPPPARIGLSCQLKEIHPQAQW
LGLGPHENYPDRRLAAQFGRWQQPLEALHTPYIFPGENGLRCETRSLLYGGWHIDGRFHF
SLSRYGLRQLMECSHQHLLQPEAGTWLSLDGFHMGVGGDDSWSPSVNQDYLLSGSHYHYQ
LRLKRAERS
NT seq 3090 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcctgccctatccttccctgaaagacctcctcgcccgccgggactggcaaaat
ccggcctgtacccattatcagcggctggctgcacatccacctttctcgagctggcgcaac
ctgaatgccgcccgtgatgacaagagcagcgagagccggcaaatattgaacggcgactgg
cagttcagctatttcgataagccccaggcggtacccgacggttggttacaacaggacctg
accgacgcagatactcttgcggtgccgtccaactggcaacttgccgcttatgacgcgccg
atctacaccaacgtccgctacccgatcccggtcaatccgccacaggtaccagaggaaaac
ccgaccggctgctattcgcggcagtttaccgtcgaccctgcctggctggcggaaggccag
acgcgcatcatttttgacggcgtcaactcggcgttttatctgtggtgcaacggccactgg
gtcggttattcacaggacagccgcctgcccgccgagtttgatctcagcccctggttgcag
gccggtgagaaccgactggcggtgatggtgctgcgctggtgcgatggcagctatctggaa
gatcaggatatgtggcgcatgagcggtattttccgcgacgtcagcctgctgcataaaccc
gccacgcatctgagcgatatccgcatcaccaccccgctgtatgacagtttccgccgtggc
gaactggtggcggaagttcacatcaaccagcccgcgcagcaccgggtacagttgcagcta
tggcgtgatggccagctggttggggaaaaaactcaggcattcggcagtgaaattatcgac
gaacgcggtgcctatgaggatcgcactaccctgtgcctcccggtggaacaaccggcgttg
tggagcgcggaaacacccacgctgtaccgcgcaaccgtcaccctgctgtcgccggaagga
aaaattattgaggtggaggcctatgacgtcggcttccgccaggtggaaatcagcaatgga
ctgctgaagcttaacggccagcccttgttgatccgcggtaccaaccgccacgaacatcat
ccgcagcacggccaggtgatggacgaggccaccatgcgccatgacatcctgctgatgaag
caacacaacttcaacgcggtgcgctgctcacactacccgaaccatccattgtggtaccgg
ttatgcgatcgctacgggctgtatgtggtggatgaagccaatattgaaacccacggcatg
cagccgatgaaccggttgtctgacgatccgctatggttgccggcaatgagcgaacgcgta
acccgcatggtgcagcgtgaccgcaaccacccttgtattattatctggtcgctgggtaac
gaatccggtcacggctgcaaccacgacgcgctgtatcgctgggtgaaaactcaggatcct
acccgcccggttcagtacgaaggcgggggggccaacagcgccgccaccgatattatctgc
ccgatgtatgcgcgggtggatcaggatcagccgttccccgccgtgcccaagtggtcaatc
aaaaagtggatcggcctgccggatgagcatcgtccgctgatcctgtgcgaatacgctcat
gcgatgggcaacagcttcgggggttttgaccgctactggcaggccttccgtcagtatccg
cgcctgcagggtggcttcgtctgggactgggtcgatcaggcactgacccgcagtgatgaa
aacggcaacccttactgggcttacggtggcgactttggcgacacgccgaacgatcgacaa
ttctgccttaacggtctggtattccccgaccgcacaccccaccctgcgctgtttgaagcg
caacgcgcacagcaatttttccagtttaccttcgacgccgaaacgctgacgctgaccgtc
aacagcgagtatctgttccgccaaaccgataatgaacggctgaactggcggctggaactc
gatggcacggagcgcgccagcggcagcttcgatctcaacctgctaccgcagagtagcgcc
agcttcccactgctcgaacgcttgccgatgctccatcaacccggcgaactgtggctgaat
gtcgaagtggtgcaaccgctggccaccgactggtccgaagccaaccatcgctgcgcctgg
gatcaatggctggtgccacgcacgctgcattttgcaccaccagcagtggccggttcagcg
ccacagctgagccaaaatgaccaaactatcgacataacccatggccatcaacgctggcag
tttacgcgccacgacggctgcctgagccaatggtggcaacatgaccactctcaactgctg
acgccactgcgcgataactttatccgcgcgccgctggataacgacatcggcatcagcgaa
gtcgagcgcatcgatcccaacgcctgggtagaacgctggaagctggcgggcatgtatcgg
ctggaggagcgctgcacgctgttgcaggccgatcaattgagcgacggcgtgcgggtggtg
agtgaacacctgttcgaagccgatgggcaaacgctgctgcgcagtcgcaaacagtggctg
ttcgacagcgagggcgccgtcagcatcagcgtcgacgtcgatattgccgccagtctgccg
ccaccggcacgtattggcctgagctgccaattgaaagaaattcatccacaggcgcaatgg
ttggggctgggcccacatgagaattacccggaccgccgcctcgccgcgcaatttggacgt
tggcagcagccgctggaagcgttgcacacgccgtatatcttccccggcgagaacgggctg
cgctgcgagacccgcagcctgctgtacggtggctggcacatcgacggacggttccacttc
tcgctcagccgctacggcctgcgccagttgatggagtgcagccaccagcacctgctgcaa
ccggaagccggcacctggctcagcctggacggtttccacatgggggtgggcggtgacgac
tcctggagcccgagcgttaatcaggactacctgctcagcggcagccattaccattatcaa
ctgcgtctaaaacgcgcagaacggagctaa

DBGET integrated database retrieval system